SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g39370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g39370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g39370

Feature Type:gene_model
Chromosome:Gm10
Start:47057939
stop:47059728
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g39370
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G22425AT Annotation by Michelle Graham. TAIR10: imidazoleglycerol-phosphate dehydratase | chr3:7951110-7952853 FORWARD LENGTH=270 SoyBaseE_val: 3.00E-69ISS
GO:0000105GO-bp Annotation by Michelle Graham. GO Biological Process: histidine biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004424GO-mf Annotation by Michelle Graham. GO Molecular Function: imidazoleglycerol-phosphate dehydratase activity SoyBaseN/AISS
PTHR23133Panther IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE HIS7 JGI ISS
PTHR23133:SF2Panther IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE HIS7 JGI ISS
PF00475PFAM Imidazoleglycerol-phosphate dehydratase JGI ISS
UniRef100_I3T3H2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Imidazoleglycerol-phosphate dehydratase n=1 Tax=Lotus japonicus RepID=I3T3H2_LOTJA SoyBaseE_val: 4.00E-70ISS
UniRef100_UPI000233CAC0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CAC0 related cluster n=1 Tax=unknown RepID=UPI000233CAC0 SoyBaseE_val: 3.00E-75ISS

Expression Patterns of Glyma10g39370
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g39370 not represented in the dataset
Glyma10g39370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g39370
ParalogEvidenceComments
Glyma20g28420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g39370 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g248300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g39370
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g39370
>Glyma10g39370.2   sequence type=CDS   gene model=Glyma10g39370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAACTTGCTTCACACGGGCTGTTCGATGTACGCATAAAGGCTACAGGTGACATACATATTGATGATCATCACACGAATGAAGACGTTGCCCTTGCTATTGGAACCGCTTTGCTGCATGCTCTTGGCGATAGGAAGGGTATTAACCGGTTTGGTAACTTCTCTGCTCCACTGGATGAAGCATTAATCCATGTTTCACTGGATTTGTCTGGCCGACCACATCTAAGTTATAATTTGGACATACCCACTCAGAGGGTTGGGACATATGATACTCAGTTGGTGGAGCATTTCTTCCAATCCCTGGTGAACACGTCTGGTATGACACTTCACATTCAGCAGGTATTAATACATAGAACTTAG
Predicted protein sequences of Glyma10g39370
>Glyma10g39370.2   sequence type=predicted peptide   gene model=Glyma10g39370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QLASHGLFDVRIKATGDIHIDDHHTNEDVALAIGTALLHALGDRKGINRFGNFSAPLDEALIHVSLDLSGRPHLSYNLDIPTQRVGTYDTQLVEHFFQSLVNTSGMTLHIQQVLIHRT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo