SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g39320

Feature Type:gene_model
Chromosome:Gm10
Start:47027885
stop:47031995
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g39320
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14880AT Annotation by Michelle Graham. TAIR10: O-acetylserine (thiol) lyase (OAS-TL) isoform A1 | chr4:8518209-8520050 REVERSE LENGTH=322 SoyBaseE_val: 9.00E-147ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006535GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process from serine SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0009805GO-bp Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004124GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine synthase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0030170GO-mf Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding SoyBaseN/AISS
KOG1252 KOG Cystathionine beta-synthase and related enzymes JGI ISS
PTHR10314Panther PYRIDOXAL-5-PHOSPHATE DEPENDENT BETA FAMILY JGI ISS
PTHR10314:SF8Panther THREONINE DEHYDRATASE JGI ISS
PF00291PFAM Pyridoxal-phosphate dependent enzyme JGI ISS
UniRef100_I1LE45UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine synthase n=1 Tax=Glycine max RepID=I1LE45_SOYBN SoyBaseE_val: 4.00E-172ISS
UniRef100_UPI000233CADEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CADE related cluster n=1 Tax=unknown RepID=UPI000233CADE SoyBaseE_val: 3.00E-179ISS

Expression Patterns of Glyma10g39320
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g39320
ParalogEvidenceComments
Glyma20g28631 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g39320 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g247900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g39320
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g39320
>Glyma10g39320.1   sequence type=CDS   gene model=Glyma10g39320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTTGAAAAGTCTGGAATTGCCAAAGATGGTACAGAGTTGATCGGCAAAACCCCATTAGTATATCTGAATAAAATCGCAGATGGTTCTGCTGCGCGGGTTGCTGCCAAACTGGAGTTGATGGAGCCATGCTCTAGTGTAAAAGACAGGATTGCCTATAGTATGATTGCTGATGCAGAGGAGAAGGGACTTATCACACCTGGACAGAGTATCCTTATTGAGCCAACAAGTGGTAATAATGGGATTGGATTAGCCATCCTGGCAGCAGCCAAAGGTTACAAGCTTATAATCACAATGCCTGCTTCAATGAGTCTTGAAAGAAGAACCATTCTTCTGTCTTTTGGAGCTGAGTTGATAAGACTCCCAACAGCTGCATACTTCAGCAATTTGAAAAACCCTGCCAATCCTAAGGTACATTATGAAACCACTGGTCCAGAGATATGGGAAGGCACAGGAGGGAAAGTTGATGCACTTGTTAGTGGTATAGGTACTGGTGGTACCATAACGGGTGTAGGGAAATTTCTTAAAGAGAAGAATCCTAATATAAAGCTCTATAGTGTGGAACCAGTTGAAAGTCCAGTACTCTCTGGAGGAAAACCTGGTCCACACAAGATTCAAGGGATTGGTGCTGGTTTTGTCCCTGGAGTATTGGAAGTTAGCCTTGTAGATGAAGTAGTTCAAATATCAAGTGATGAAGCTATAGAAACTGCAAAACTTCTTGCACTTAAAGAAGGCCTATTTGTTGGAATATCATCTGGAGCTGCAGCTTCAGCTGCCATTAAGATAGCGAAAAGATCAGAAAATGCTGGAAAGCTTATTGTAGTTATTTTCCCAAGCTTTGGTGAGTGGTATCTGTCCTCTGTGCTGTTTGAGTCAATCAGACAGGAAGCTGAAAGTCTTACTTTTGAATCCTGA
Predicted protein sequences of Glyma10g39320
>Glyma10g39320.1   sequence type=predicted peptide   gene model=Glyma10g39320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVEKSGIAKDGTELIGKTPLVYLNKIADGSAARVAAKLELMEPCSSVKDRIAYSMIADAEEKGLITPGQSILIEPTSGNNGIGLAILAAAKGYKLIITMPASMSLERRTILLSFGAELIRLPTAAYFSNLKNPANPKVHYETTGPEIWEGTGGKVDALVSGIGTGGTITGVGKFLKEKNPNIKLYSVEPVESPVLSGGKPGPHKIQGIGAGFVPGVLEVSLVDEVVQISSDEAIETAKLLALKEGLFVGISSGAAASAAIKIAKRSENAGKLIVVIFPSFGEWYLSSVLFESIRQEAESLTFES*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo