SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g39281): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g39281): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g39281

Feature Type:gene_model
Chromosome:Gm10
Start:47006568
stop:47007906
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g39281
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G05420AT Annotation by Michelle Graham. TAIR10: ovate family protein 12 | chr1:1590073-1590753 FORWARD LENGTH=226 SoyBaseE_val: 3.00E-25ISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PF04844PFAM Protein of unknown function, DUF623 JGI ISS
UniRef100_G7IDP8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene receptor n=1 Tax=Medicago truncatula RepID=G7IDP8_MEDTR SoyBaseE_val: 1.00E-29ISS
UniRef100_I1LE42UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LE42_SOYBN SoyBaseE_val: 3.00E-81ISS

Expression Patterns of Glyma10g39281
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g39281 not represented in the dataset
Glyma10g39281 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g39281
ParalogEvidenceComments
Glyma20g28571 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g39281 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g247600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g39281
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g39281
>Glyma10g39281.1   sequence type=CDS   gene model=Glyma10g39281   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCAGTCTGTTCTCCAAACACCTCCACCTCTGTTTCTTCAAGCCCAAATATCCCACCATTCTCTGCCAACACAGCCACCACACCCCTCCACCTTCTTCTGCCGACAACTCCGACGCCACCTCATCCACCTCCACAGAACCAGACTTCGCCTCCATCTTCGCTTCGCAGCGCTTCTTCTTCTCCTCCCCGGGCACCTCCAACTCCATCGTCGAGTCCCCCGACACGCGCACCTTCGTCGTCCCCACCGGTGGCGGTGTCGGAGTCCCCAAGTACTCCCTCAACCCCTACGTCGATTTTCTCCGCTCAATGCAAGAAATGATACGTTCGCGCCAAGTCTTGGACATCACTAAAGACTCCGAATATCTCCACGAACTTCTCCTTTGCTACCTCGCTCTCAACCCCACGCACACTCACAAACATATCCTTCGCGCTTTCACCGACCTCGTCCTCGAACTCTTGTCCTCCACGACCCCGTGCCGGACGACACACAACCACAACAGCCACCGACGCCACCGTAGTCTCTCTGGAAGGTTGCTGTAA
Predicted protein sequences of Glyma10g39281
>Glyma10g39281.1   sequence type=predicted peptide   gene model=Glyma10g39281   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSLFSKHLHLCFFKPKYPTILCQHSHHTPPPSSADNSDATSSTSTEPDFASIFASQRFFFSSPGTSNSIVESPDTRTFVVPTGGGVGVPKYSLNPYVDFLRSMQEMIRSRQVLDITKDSEYLHELLLCYLALNPTHTHKHILRAFTDLVLELLSSTTPCRTTHNHNSHRRHRSLSGRLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo