Glyma10g38000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g38000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g38000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g38000

Feature Type:	gene_model
Chromosome:	Gm10
Start:	45903699
stop:	45906502
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g38000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G25590	AT	Annotation by Michelle Graham. TAIR10: actin depolymerizing factor 7 \| chr4:13059137-13060050 REVERSE LENGTH=137	SoyBase	E_val: 4.00E-86	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005884	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: actin filament	SoyBase	N/A	ISS
GO:0003779	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin binding	SoyBase	N/A	ISS
KOG1735	KOG	Actin depolymerizing factor	JGI		ISS
PTHR11913	Panther	ACTIN DEPOLYMERIZING FACTOR	JGI		ISS
PF00241	PFAM	Cofilin/tropomyosin-type actin-binding protein	JGI		ISS
UniRef100_B9I489	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Actin depolymerizing factor 10 n=1 Tax=Populus trichocarpa RepID=B9I489_POPTR	SoyBase	E_val: 2.00E-85	ISS
UniRef100_I1NGT6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NGT6_SOYBN	SoyBase	E_val: 5.00E-95	ISS

Expression Patterns of Glyma10g38000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g38000 not represented in the dataset	Glyma10g38000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g38000

Paralog	Evidence	Comments
Glyma20g29810	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g38000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g235500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g38000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g38000

Limit To All Plant Sequences

>Glyma10g38000.1   sequence type=CDS   gene model=Glyma10g38000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAACGCGGCATCTGGAATGGCTGTTATTGATGAGTGTAAATTAAAGTTCCTGGAGCTAAAGGCAAAGAGGAACTACCGTTTCATTGTGTTTAAGATTGAGAACTATGAAGTGGTAGTGGAGAAACTTGGAAGCCCCGAAGAAACCTATGACGACTTTAGTGCATCTCTGCCTGCCAATGAGTGCCGCTATGCTGTCTTTGATTTTGATTTCACCACAAATGAAAACTGCCAGAAAAGCAAGATTTTCTTCATTGCATGGGCTCCTGATACATCAAAGGTGAGAGAGAAGATGGTGTATGCCAGCTCCAAGGACAAATTCAAGAGGGAACTTGATGGCATTCAGGTTGAGTTGCAAGCAACGGATCCTAGTGAGATGAGCTTTGATATCATAAAAGCACGGGCATTATAA

Predicted protein sequences of Glyma10g38000

Limit To All Plant Sequences

>Glyma10g38000.1   sequence type=predicted peptide   gene model=Glyma10g38000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANAASGMAVIDECKLKFLELKAKRNYRFIVFKIENYEVVVEKLGSPEETYDDFSASLPANECRYAVFDFDFTTNENCQKSKIFFIAWAPDTSKVREKMVYASSKDKFKRELDGIQVELQATDPSEMSFDIIKARAL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain