SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g37950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g37950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g37950

Feature Type:gene_model
Chromosome:Gm10
Start:45873221
stop:45874359
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48990AT Annotation by Michelle Graham. TAIR10: AMP-dependent synthetase and ligase family protein | chr3:18159031-18161294 REVERSE LENGTH=514 SoyBaseE_val: 2.00E-44ISS
GO:0010030GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of seed germination SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0010214GO-bp Annotation by Michelle Graham. GO Biological Process: seed coat development SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0033611GO-bp Annotation by Michelle Graham. GO Biological Process: oxalate catabolic process SoyBaseN/AISS
GO:0046482GO-bp Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0016208GO-mf Annotation by Michelle Graham. GO Molecular Function: AMP binding SoyBaseN/AISS
GO:0050203GO-mf Annotation by Michelle Graham. GO Molecular Function: oxalate-CoA ligase activity SoyBaseN/AISS
PTHR24095Panther FAMILY NOT NAMED JGI ISS
PTHR24095:SF49Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_B9R9A8UniRef Annotation by Michelle Graham. Most informative UniRef hit: AMP dependent CoA ligase, putative n=1 Tax=Ricinus communis RepID=B9R9A8_RICCO SoyBaseE_val: 7.00E-49ISS
UniRef100_I1LDR1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LDR1_SOYBN SoyBaseE_val: 2.00E-62ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g37950 not represented in the dataset

Glyma10g37950 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g29850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g37950.1   sequence type=CDS   gene model=Glyma10g37950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAGAAAATATCACCATTAGAGGTGGATGCTGTCCTTCTATCTCATCCAGACATTGCTCAGGCAGTTGCATTCGGAGTACCAGATGACAAATATGGCGAAGAGATAAATTGTGCAATCATCCCAAAAGAAGGACCAAACATTGATGAGGCGGAGGTGCAGAGATTTAGCAAGAAGAACCTTGCAGCCTTCAAAGTCCCTAAAAAGGTCTTCTTCACTGATTCTTTACCCAAGACTGCCACTGGCAAGATTCTGAGGCGTCTTGTAGCAGAACACTTCATTTCTCAAACTTGA

>Glyma10g37950.1   sequence type=predicted peptide   gene model=Glyma10g37950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EKISPLEVDAVLLSHPDIAQAVAFGVPDDKYGEEINCAIIPKEGPNIDEAEVQRFSKKNLAAFKVPKKVFFTDSLPKTATGKILRRLVAEHFISQT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo