Glyma10g36460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g36460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g36460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g36460

Feature Type:	gene_model
Chromosome:	Gm10
Start:	44605624
stop:	44607567
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g36460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G71750	AT	Annotation by Michelle Graham. TAIR10: Hypoxanthine-guanine phosphoribosyltransferase \| chr1:26987954-26989144 REVERSE LENGTH=188	SoyBase	E_val: 8.00E-88	ISS
GO:0006166	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine ribonucleoside salvage	SoyBase	N/A	ISS
GO:0006168	GO-bp	Annotation by Michelle Graham. GO Biological Process: adenine salvage	SoyBase	N/A	ISS
GO:0006178	GO-bp	Annotation by Michelle Graham. GO Biological Process: guanine salvage	SoyBase	N/A	ISS
GO:0009116	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0032263	GO-bp	Annotation by Michelle Graham. GO Biological Process: GMP salvage	SoyBase	N/A	ISS
GO:0032264	GO-bp	Annotation by Michelle Graham. GO Biological Process: IMP salvage	SoyBase	N/A	ISS
GO:0046098	GO-bp	Annotation by Michelle Graham. GO Biological Process: guanine metabolic process	SoyBase	N/A	ISS
GO:0046100	GO-bp	Annotation by Michelle Graham. GO Biological Process: hypoxanthine metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0000287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding	SoyBase	N/A	ISS
GO:0004422	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hypoxanthine phosphoribosyltransferase activity	SoyBase	N/A	ISS
GO:0016740	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity	SoyBase	N/A	ISS
KOG3367	KOG	Hypoxanthine-guanine phosphoribosyltransferase	JGI		ISS
PTHR22573	Panther	PHOSPHOHEXOMUTASE FAMILY MEMBER	JGI		ISS
PTHR22573:SF9	Panther	HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE	JGI		ISS
PF00156	PFAM	Phosphoribosyl transferase domain	JGI		ISS
UniRef100_B4UWA8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hypoxanthine phosphoribosyltransferase n=1 Tax=Arachis hypogaea RepID=B4UWA8_ARAHY	SoyBase	E_val: 1.00E-104	ISS
UniRef100_I1LDB6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LDB6_SOYBN	SoyBase	E_val: 1.00E-130	ISS

Expression Patterns of Glyma10g36460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g36460 not represented in the dataset	Glyma10g36460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g36460

Paralog	Evidence	Comments
Glyma20g31110	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g36460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g220400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g36460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g36460

Limit To All Plant Sequences

>Glyma10g36460.1   sequence type=CDS   gene model=Glyma10g36460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATTCCCATATCGAGAGAATCCTATGGAGCGAGGACCAAATTTCTCGCCGTGTCTCCGAGCTCGCCGCCGAAATCTCCGCCGACTTCGGCGGACAATCTCCGGCTCCCGTGGTCGTCGGCGTGGCCACCGGTGCATTCCTCTTCTTGGCTGACCTCGTTCGCAAAATAGATCTGTCCATCGCCGTTGATTTCGTCCGAGTTGAATCCTACGGTTTCGGAACCGTTTCCAATGGCGCACCCACCATTTCCTTCGATTTGAAGGTCGACGTCAACGCCCGTCACGTCATCGTGGTTGAAGACATTGTAGATACTGGACATACCTTATCTAAAGTCATTGGGCACTTGAAATCAAAGGGAGTATCCTCTGTTTCTGTATGCACTTTCCTTGATAAACCTGCAAGGAGAAAAGTTCATTTTCAGTTGCTGGGTGAAGGGAAATACTACCGGGGATTTGAGTGTCCAGACTATTTCGTTGTAGGTTATGGACTGGATTTCGCTGAACTCTATAGAAATTTGCCTTACATTGGTGTTTTGAAGCCTGAACTTTACAAGTGA

Predicted protein sequences of Glyma10g36460

Limit To All Plant Sequences

>Glyma10g36460.1   sequence type=predicted peptide   gene model=Glyma10g36460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHSHIERILWSEDQISRRVSELAAEISADFGGQSPAPVVVGVATGAFLFLADLVRKIDLSIAVDFVRVESYGFGTVSNGAPTISFDLKVDVNARHVIVVEDIVDTGHTLSKVIGHLKSKGVSSVSVCTFLDKPARRKVHFQLLGEGKYYRGFECPDYFVVGYGLDFAELYRNLPYIGVLKPELYK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain