Report for Sequence Feature Glyma10g36021
Feature Type: gene_model
Chromosome: Gm10
Start: 44206027
stop: 44207706
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g36021
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G09600 AT
Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 3 | chr4:6073014-6073516 REVERSE LENGTH=99
SoyBase E_val: 4.00E-27 ISS
GO:0009739 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF02704 PFAM
Gibberellin regulated protein
JGI ISS
UniRef100_B9SLF4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein 2, putative n=1 Tax=Ricinus communis RepID=B9SLF4_RICCO
SoyBase E_val: 8.00E-34 ISS
UniRef100_I1LD72 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LD72_SOYBN
SoyBase E_val: 3.00E-39 ISS
Expression Patterns of Glyma10g36021
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma10g36021
Paralog Evidence Comments
Glyma20g31571 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g36021 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g216100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g36021
Coding sequences of Glyma10g36021
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g36021.1 sequence type=CDS gene model=Glyma10g36021 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCATCTCAAAAAGCACAGTGGTCGTAGTTATTCTCTGCTTCATCCTTATACAAGAGTTGGGGATCTATGGTGAAGATCCACACATGGATGCTGCCAAGAAGATAGATTGCGGTGGCAAGTGCAATTCCAGGTGCAGTAAGGCTAGGAGGCAAAAAATGTGCATTAGGGCATGCAATAGTTGCTGCAAGAAGTGCAGGTGCGTGCCACCCGGCACTTCTGGGAACCGAGATTTGTGCCCTTGCTATGCTAGACTCACCACACATGGAGGAAAGCTCAAGTGCCCATGA
Predicted protein sequences of Glyma10g36021
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g36021.1 sequence type=predicted peptide gene model=Glyma10g36021 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAISKSTVVVVILCFILIQELGIYGEDPHMDAAKKIDCGGKCNSRCSKARRQKMCIRACNSCCKKCRCVPPGTSGNRDLCPCYARLTTHGGKLKCP*