SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g35860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g35860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g35860

Feature Type:gene_model
Chromosome:Gm10
Start:44072993
stop:44073881
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g35860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54750AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 145 Blast hits to 145 proteins in 60 species: Archae - 0; Bacteria - 0; Metazoa - 99; Fungi - 0; Plants - 40; Viruses - 0; Other Eukaryotes - 6 (source: NCBI BLink). | chr3:20264833-20268416 REVERSE LENGTH=589 SoyBaseE_val: 7.00E-11ISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q8GXI8UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3G54750 protein n=1 Tax=Arabidopsis thaliana RepID=Q8GXI8_ARATH SoyBaseE_val: 3.00E-08ISS
UniRef100_UPI000233C1F5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C1F5 related cluster n=1 Tax=unknown RepID=UPI000233C1F5 SoyBaseE_val: 4.00E-46ISS

Expression Patterns of Glyma10g35860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g35860 not represented in the dataset
Glyma10g35860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g35860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g35860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g35860
>Glyma10g35860.1   sequence type=CDS   gene model=Glyma10g35860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAAAGTGGCTAAACCAAGTTCTGTGCCCTCGAGCTCTCACCAACTTGGCTCCGGACCTTTGAAAACTGGATCTATGGCTAGAAAGAAGACACCGTCAGAACTTAGGACTCGGCGATTAAGGTCATTCTATGATGTTGATAATAGCCCAGAATCTTTGCTGGCTTTTAGTGGCAACAACAATGTACATGCTTTATATGACTTTTTACTAAATTACAGGTTTTTTAATTGA
Predicted protein sequences of Glyma10g35860
>Glyma10g35860.1   sequence type=predicted peptide   gene model=Glyma10g35860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKVAKPSSVPSSSHQLGSGPLKTGSMARKKTPSELRTRRLRSFYDVDNSPESLLAFSGNNNVHALYDFLLNYRFFN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo