SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G32915 | AT | Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: regulation of translational fidelity; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Glu-tRNAGln amidotransferase, C subunit (InterPro:IPR003837); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:15885549-15886628 FORWAR | SoyBase | E_val: 1.00E-35 | ISS |
| GO:0006450 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of translational fidelity | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PTHR13373 | Panther | FROUNT PROTEIN-RELATED | JGI | ISS | |
| PTHR13373:SF14 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF02686 | PFAM | Glu-tRNAGln amidotransferase C subunit | JGI | ISS | |
| UniRef100_I1NHC7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial n=1 Tax=Glycine max RepID=I1NHC7_SOYBN | SoyBase | E_val: 3.00E-92 | ISS |
| UniRef100_UPI000233C1F4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C1F4 related cluster n=1 Tax=unknown RepID=UPI000233C1F4 | SoyBase | E_val: 6.00E-100 | ISS |
|
Glyma10g35841 not represented in the dataset |
Glyma10g35841 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma20g31750 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.10g214200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma10g35841.1 sequence type=CDS gene model=Glyma10g35841 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGTAGCAAAGGGTTGCTGAGAGGAGCTTCGTTAACTGCAAACGCAGTGTGGCATAGAAGCAGTTTCTTCCCAAAGGTAACGGTTAGCGTCCACCGCAAGTTGGTGAAATTTCGAAGCTTCTCATTAACCACCACTTGCTCCTCTCTTCTACCTCCGGATTTGCCGCGTTTGGCAAAAACGGCTCAAATTTCACTTACCCCAAACGAGGTTGAAGAAATTGCTCCCAAAATTCAACAAGTTATAGAATGGTTTGGACAGCTTCAGGGTGTTGATCTTGAAAGTGTTGAACCCTCGATCAGAGCAGAGACGGAAAACAATTTGCGTGATAATGATCCTGAAACATTTGACCATAGGGACGCCTTGATCGCTTCTGTCCCGAGCTATGAGGAGCCTTATATTAAAGTTCCGAGGGTCTTAAGCATGGACTAA
>Glyma10g35841.1 sequence type=predicted peptide gene model=Glyma10g35841 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSSKGLLRGASLTANAVWHRSSFFPKVTVSVHRKLVKFRSFSLTTTCSSLLPPDLPRLAKTAQISLTPNEVEEIAPKIQQVIEWFGQLQGVDLESVEPSIRAETENNLRDNDPETFDHRDALIASVPSYEEPYIKVPRVLSMD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
