SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g35050

Feature Type:gene_model
Chromosome:Gm10
Start:43232666
stop:43234194
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g35050
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G13540AT Annotation by Michelle Graham. TAIR10: myb domain protein 5 | chr3:4420239-4421443 FORWARD LENGTH=249 SoyBaseE_val: 2.00E-53ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0010026GO-bp Annotation by Michelle Graham. GO Biological Process: trichome differentiation SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010214GO-bp Annotation by Michelle Graham. GO Biological Process: seed coat development SoyBaseN/AISS
GO:0010468GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression SoyBaseN/AISS
GO:0048354GO-bp Annotation by Michelle Graham. GO Biological Process: mucilage biosynthetic process involved in seed coat development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_A4GZI2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor DcMYB3-1 n=1 Tax=Daucus carota RepID=A4GZI2_DAUCA SoyBaseE_val: 2.00E-57ISS
UniRef100_I1LCV5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LCV5_SOYBN SoyBaseE_val: 1.00E-117ISS

Expression Patterns of Glyma10g35050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g35050 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g206400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g35050
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g35050
>Glyma10g35050.2   sequence type=CDS   gene model=Glyma10g35050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTGTGACAACCGAGATGCTGTGAACAGAGGTGCTTGGTCAGCTGAGGAAGACCAAATCCTTATCAACTACGTTCAAGCCCATGGAGAAGGAAATTGGAGAGAGCTTTCCAAAAGAGCTGGTTTAAAACGACGTGGGAAGAGTTGCAGACTCAGATGGTTGAACTATCTCAAGCCAGATATCAAGAGAGGAAACATTTCTTCGGATGAAGAAGATCTCATCATCAGGCTTCATAGCCTCTTAGGCAATAGGTGGTCTCTTATTGCGGGACGATTACCTGGGCGAACAGATAATGAAATCAAGAACTATTGGAATACTTATTTGAGAAAGAAGGTTGAGCAAAATCACAACTATAACAGTAATCTTCCTGGTCATGATAACATTCCTATCAAATTAAGAATTGAATCTCCACGGCGCTCAAAAAATTCATTGGGTATTGTTATTGATCCTACAAAATCCTCTCACCCAATGACGATTAAATCAATGAGGTGCACCGAG
Predicted protein sequences of Glyma10g35050
>Glyma10g35050.2   sequence type=predicted peptide   gene model=Glyma10g35050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSCDNRDAVNRGAWSAEEDQILINYVQAHGEGNWRELSKRAGLKRRGKSCRLRWLNYLKPDIKRGNISSDEEDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTYLRKKVEQNHNYNSNLPGHDNIPIKLRIESPRRSKNSLGIVIDPTKSSHPMTIKSMRCTE






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo