SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g33941): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g33941): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g33941

Feature Type:gene_model
Chromosome:Gm10
Start:42148763
stop:42149209
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g33941
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06490AT Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr5:1977996-1978589 REVERSE LENGTH=197 SoyBaseE_val: 1.00E-20ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR14155Panther RING FINGER PROTEIN 6/12/38 JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_B9III9UniRef Annotation by Michelle Graham. Best UniRef hit: Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9III9_POPTR SoyBaseE_val: 7.00E-26ISS
UniRef100_G7I3Z7UniRef Annotation by Michelle Graham. Most informative UniRef hit: RING finger protein n=1 Tax=Medicago truncatula RepID=G7I3Z7_MEDTR SoyBaseE_val: 2.00E-22ISS

Expression Patterns of Glyma10g33941
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g33941 not represented in the dataset
Glyma10g33941 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g33941
ParalogEvidenceComments
Glyma20g33661 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g33941 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g195400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g33941
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g33941
>Glyma10g33941.1   sequence type=CDS   gene model=Glyma10g33941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATAGTTCAGAGGAAACCGCGCTATTGCTTGTGAGCTTTATTGTTCTAACCCTTATAATTACACTCACAGCATATGTGTGCTCTAATAACATTCCACGCACTGTTCCATCTGTGCCTGGTGGTGCCACACACTCCAACAACAACCACACTACAATCACTGTGGAGCCACCCGAGCCACGCTTAGATCACACCAATGTACGAAGCTATCCAAGTCTTCAATTCTCCAAAGCTAAATTGTGTAGTAGCAATAGTAGTAGTAGTAGCTCTTCAAGTTGTTCCATATGCTTGATGGATTACAAAGATTGTGATTCCTTGAAAGTGCTTCCTGCTTGTGGTCATTTCTTCCATGTCAAGTGTGTTGATCCTTGGTTGAGAATCAGTTTGACATGCCCGGTTTGTAGGACCCCAATAGCACTCCCAGATATATGTAAAAATTTGGAATGA
Predicted protein sequences of Glyma10g33941
>Glyma10g33941.1   sequence type=predicted peptide   gene model=Glyma10g33941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNSSEETALLLVSFIVLTLIITLTAYVCSNNIPRTVPSVPGGATHSNNNHTTITVEPPEPRLDHTNVRSYPSLQFSKAKLCSSNSSSSSSSSCSICLMDYKDCDSLKVLPACGHFFHVKCVDPWLRISLTCPVCRTPIALPDICKNLE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo