Glyma10g33720 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g33720

Feature Type:	gene_model
Chromosome:	Gm10
Start:	42005475
stop:	42006595
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g33720

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G07475	AT	Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein \| chr5:2364827-2365536 REVERSE LENGTH=192	SoyBase	E_val: 2.00E-46	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF02298	PFAM	Plastocyanin-like domain	JGI		ISS
UniRef100_C6T1Y3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1Y3_SOYBN	SoyBase	E_val: 3.00E-134	ISS
UniRef100_G7I2Z3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Blue copper protein n=1 Tax=Medicago truncatula RepID=G7I2Z3_MEDTR	SoyBase	E_val: 2.00E-81	ISS

Expression Patterns of Glyma10g33720

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g33720

Paralog	Evidence	Comments
Glyma20g33870	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g33720 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g193600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g33720

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g33720

Limit To All Plant Sequences

>Glyma10g33720.1   sequence type=CDS   gene model=Glyma10g33720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAGTTACTCTTAGTCTATTCTCTTCTCTTTTCTGTAGTGATTATCACATGCTCAGCCACTACTTACACGGTTGGAGATAGCTCTGGCTGGGACATTAGCACAAATCTTGATGCATGGATTGCAGATAAGAATTTCAGAGTAGGGGATGCTCTTGTTTTCCAATATTCATCAGGCCAAAGTGTAGAAGAGGTTACAAAAGAAAACTTCAACACATGCAACACCACCAATGTTTTAGCAACTCATGGAAATGGGAACACAACAGTGCCATTGACGAGAGCTGGAGACAGGTATTTTGTATCTGGAAACAAGTTGTATTGCCTTGGAGGGATGAAACTTCATGCTCATGTCCAAGGCGACGATAAATCACTAGCACCAACTCTAGCACCTAAGGCTGTGGCTGGATCAGATCAAAACACCGCCACACTTCCACAGTCTCCTTCATCAAAGAAGAACACACATCTTTCGGCAGGAGCGGCAAATCCTGCAAGGGATGCACTTCATCTAGTTTATATTGCTCCTATGGCTGCTATATATGGGATGATGAAGATTTGA

Predicted protein sequences of Glyma10g33720

Limit To All Plant Sequences

>Glyma10g33720.1   sequence type=predicted peptide   gene model=Glyma10g33720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKLLLVYSLLFSVVIITCSATTYTVGDSSGWDISTNLDAWIADKNFRVGDALVFQYSSGQSVEEVTKENFNTCNTTNVLATHGNGNTTVPLTRAGDRYFVSGNKLYCLGGMKLHAHVQGDDKSLAPTLAPKAVAGSDQNTATLPQSPSSKKNTHLSAGAANPARDALHLVYIAPMAAIYGMMKI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain