SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g33531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g33531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g33531

Feature Type:gene_model
Chromosome:Gm10
Start:41874368
stop:41877544
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g33531
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G22980AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S5/Elongation factor G/III/V family protein | chr3:8160269-8163316 REVERSE LENGTH=1015 SoyBaseE_val: 2.00E-32ISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
GO:0008135GO-mf Annotation by Michelle Graham. GO Molecular Function: translation factor activity, nucleic acid binding SoyBaseN/AISS
PTHR26328Panther FAMILY NOT NAMED JGI ISS
PTHR26328:SF3Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_B9RPP6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Translation elongation factor, putative n=1 Tax=Ricinus communis RepID=B9RPP6_RICCO SoyBaseE_val: 3.00E-30ISS
UniRef100_I1N883UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N883_SOYBN SoyBaseE_val: 2.00E-33ISS

Expression Patterns of Glyma10g33531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g33531 not represented in the dataset
Glyma10g33531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g33531 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g191800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g33531
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g33531
>Glyma10g33531.1   sequence type=CDS   gene model=Glyma10g33531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAAGAAGGTTCCCCTTTCTTCACTGTGCATGCGTATCTTCCTGTTTCTGAGAGCTTTGGTTTTGCCGATGAGCTTAGAATTCCTGAGGATCCTTTCTTTGTACCTAAAACGGAAGAGGAAGTTGAAGAGTTTGGAGATGGTTCTAGTGTTCTTCCAAATACTGCAAGAAAATTGATTAATGCAGTCGGACGGCGTAAGGGCCTTTCTGTGGGAAAAAGGTTGCCATTTAATCTAATTTGCATGTGA
Predicted protein sequences of Glyma10g33531
>Glyma10g33531.1   sequence type=predicted peptide   gene model=Glyma10g33531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQEGSPFFTVHAYLPVSESFGFADELRIPEDPFFVPKTEEEVEEFGDGSSVLPNTARKLINAVGRRKGLSVGKRLPFNLICM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo