SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g33481): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g33481): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g33481

Feature Type:gene_model
Chromosome:Gm10
Start:41836666
stop:41838648
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G17740AT Annotation by Michelle Graham. TAIR10: Peptidase S41 family protein | chr4:9867088-9869719 REVERSE LENGTH=505 SoyBaseE_val: 4.00E-87ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0008236GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type peptidase activity SoyBaseN/AISS
PTHR18868Panther SERINE PROTEASE JGI ISS
PTHR18868:SF10Panther SERINE PROTEASE JGI ISS
PF00595PFAM PDZ domain (Also known as DHR or GLGF) JGI ISS
UniRef100_G7I2N9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Carboxyl-terminal-processing protease n=1 Tax=Medicago truncatula RepID=G7I2N9_MEDTR SoyBaseE_val: 8.00E-121ISS
UniRef100_UPI000233D64AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D64A related cluster n=1 Tax=unknown RepID=UPI000233D64A SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g33481 not represented in the dataset

Glyma10g33481 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g34110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g191300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g33481.1   sequence type=CDS   gene model=Glyma10g33481   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACAGTGGAAGTGTTTTTCGTTAAGGGTAATAGAATCTCGGTTTCCATTGGCACATAGAAGGAAGAAAGGTGTTGGTTCTAGAAATAGGGATTCTTGGAAAGAATATTCAATTGGGTTGGTGCCACGAATAAGCAGCATCTCTTATCCTCATTGTGGTTATTTTCCATCAAGTGGGGGTTTCATTGCAAAAAGGAGGAAACGTAACAGTCTTCTGAGACTGAATGATTGTTCAGACAACATAAGACAACATGCTTCTATTTTGTTTGTGCGGCTGGTTAGTGGAGTAATGTTGGTCATGTCTGTTTCTTTGGCTTCTACTGAGCCATCCTCGTATATTGATAAAAGTTTTAATGGGCAGAGTTGGTTTAGGTATAGAGAAGATGCACTCCGCAATGAACCAATGAACAATCGAGAAGAGACATATAAGGTGATAAGAAAGATGCTTGCCACATTGGATGATCCATTCACTAGATTTTTGGAGCCTGAAAAGTTCAGAAGTTTGAGGTCTGGAACTGAAGGCGCTCTAACTGGAGTGGGGTTATCAATAGGCTACCCTACCAAAGCTGAAATGCAACCTGGTGGGCTTGTTGTCATTTCAGCTTCTCCAGGAGGTCCTGCATACAGAGTTGGTGTTTTGTCTGGAGATGTTATCCTGGCTATTGATTGTACAAGCACAGAAAACATGGGGCTGTATGATGCAGCTGAACGCCTACAGAGAGAGAAAGTTTCATTGGATCCAGTGAAATCAAGATTGTGCAAGCTACCTGCTTCAGGAAATGATTCCCCAACGGTTGGTTATATCAAACTAACATCTTTCAACCAAAAGGCATCTAGTAACTTTAGAGAGCCAACATTTGGAAAA

>Glyma10g33481.1   sequence type=predicted peptide   gene model=Glyma10g33481   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSQWKCFSLRVIESRFPLAHRRKKGVGSRNRDSWKEYSIGLVPRISSISYPHCGYFPSSGGFIAKRRKRNSLLRLNDCSDNIRQHASILFVRLVSGVMLVMSVSLASTEPSSYIDKSFNGQSWFRYREDALRNEPMNNREETYKVIRKMLATLDDPFTRFLEPEKFRSLRSGTEGALTGVGLSIGYPTKAEMQPGGLVVISASPGGPAYRVGVLSGDVILAIDCTSTENMGLYDAAERLQREKVSLDPVKSRLCKLPASGNDSPTVGYIKLTSFNQKASSNFREPTFGK







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo