Glyma10g33380 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g33380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g33380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g33380

Feature Type:	gene_model
Chromosome:	Gm10
Start:	41756661
stop:	41758670
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g33380

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G14920	AT	Annotation by Michelle Graham. TAIR10: GRAS family transcription factor family protein \| chr1:5149414-5151015 FORWARD LENGTH=533	SoyBase	E_val: 8.00E-151	ISS
GO:0006808	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of nitrogen utilization	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009938	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010029	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of seed germination	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0010187	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination	SoyBase	N/A	ISS
GO:0010218	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to far red light	SoyBase	N/A	ISS
GO:0010233	GO-bp	Annotation by Michelle Graham. GO Biological Process: phloem transport	SoyBase	N/A	ISS
GO:0010325	GO-bp	Annotation by Michelle Graham. GO Biological Process: raffinose family oligosaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0048444	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ morphogenesis	SoyBase	N/A	ISS
GO:2000033	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of seed dormancy process	SoyBase	N/A	ISS
GO:2000377	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of reactive oxygen species metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF03514	PFAM	GRAS family transcription factor	JGI		ISS
PF12041	PFAM	Transcriptional regulator DELLA protein N terminal	JGI		ISS
UniRef100_I1LCF0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LCF0_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q0HA68	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DELLA protein n=1 Tax=Malus x domestica RepID=Q0HA68_MALDO	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma10g33380

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g33380 not represented in the dataset	Glyma10g33380 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g33380

Paralog	Evidence	Comments
Glyma20g34260	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g33380 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g190200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g33380

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g33380

Limit To All Plant Sequences

>Glyma10g33380.1   sequence type=CDS   gene model=Glyma10g33380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAATGATTTCATCTGCCTCCAACGAAAACAAGACGGTGGTGGACATGGACGACCACCTCGCCGGCCTGGGATACAAAGTCCGTTCATCGGAGCTGTGTCAAGTGGCTGCAAACATGGAGCGTTTAGAAAACGTGATTTCATCCACCGACCTATCTCAACTCGCATCAGACACAACCCTCTACGATCCTTCCAACATAGGGTTAGGTTCGTGGGTGGACACGCTCCTCTCCGAGTTCGACCAAACGGCGTCGTTACCGTTACAATACGATTTCGCCACGGATCCAAACCATAACAAGCAATTAGCGCTGGTCACCACCGTGGAAGAAGACTCGGGGATAAGACTGGTTCACATGCTGATGACGTGTGCTGATTCCGTGCAACGTGGTGACTTCTCATTCGCTGGCTCCCTCATTGAGAACATGCAGGGGTTGTTGGCGCACGTGAACACCAACTGCGGCATCGGAAAAGTCGCCGGCTACTTCATCGACGCCTTGCGCCGCCGCATCTCGAACACGCTTCCAACGTCATCATCCACTTACGAGAACGACGTTCTCTACCACAACTACTACGAAGCGTGTCCTTACTTGAAGTTCGCGCACTTCACCGCGAACCAGGCGATCTTGGAGGCCTTCAACGGCCACGATTGCGTCCACGTCATCGACTTCAACCTCATGCAAGGGCTCCAGTGGCCAGCGCTGATACAGGCACTGGCGCTCCGTCCCGGCGGACCGCCGCTGCTGAGGCTCACCGGTGTCGGGCCTCCCTCGGCGGAAAACCGCGACAATCTCCGCGAGATCGGGCTGAGACTCGCCGAGCTGGCGCGGTCCGTGAACGTGCGGTTCGCGTTCCGCGGCGTGGCGGCGTGGAGGCTGGAGGACGTGAAGCCGTGGATGTTACAGGTGAGTCTGAACGAGGCGGTGGCGGTGAACTCGATAATGCAGCTGCACCGGGTCACGGCGGTGGACGCCGCCGTGGAAGAAGTTCTCAGTTGGATCCGGAGTCTGAACCCTAAAATAGTGACGGTTGTGGAACAAGAAGCTAACCACAACGGGGAAGGGTTTTTGGAGCGGTTCACGGAGGCTTTGCATTACTATTCCACCGTCTTCGACTCGCTCGACGCGTGCCCGGTCGAACCGGACAAGGCTGCTTTGGCGGAGATGTATTTGCAGAGGGAGATATGCAACGTGGTGTGCTGTGAGGGACCGGCGCGGCTCGAGCGCCACGAGCCGCTCGCTAAGTGGAGGGATCGGCTCGGGAAAGCCGGCTTCAGACCCTTGCATTTGGGTTTCAACGCCTACAAGCAAGCCAGCATGTTGCTCACTCTGTTCTCAGCCGAGGGTTTCTGCGTCCAAGAGAATCAAGGCTCTTTGACACTGGGCTGGCATAGCCGCCCCTTAATCGCAGCTTCGGCTTGGCAAGCCGCGCCGCTGAGAGATGACGAAACGCTGCGTTTTGGGCATTGA

Predicted protein sequences of Glyma10g33380

Limit To All Plant Sequences

>Glyma10g33380.1   sequence type=predicted peptide   gene model=Glyma10g33380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMISSASNENKTVVDMDDHLAGLGYKVRSSELCQVAANMERLENVISSTDLSQLASDTTLYDPSNIGLGSWVDTLLSEFDQTASLPLQYDFATDPNHNKQLALVTTVEEDSGIRLVHMLMTCADSVQRGDFSFAGSLIENMQGLLAHVNTNCGIGKVAGYFIDALRRRISNTLPTSSSTYENDVLYHNYYEACPYLKFAHFTANQAILEAFNGHDCVHVIDFNLMQGLQWPALIQALALRPGGPPLLRLTGVGPPSAENRDNLREIGLRLAELARSVNVRFAFRGVAAWRLEDVKPWMLQVSLNEAVAVNSIMQLHRVTAVDAAVEEVLSWIRSLNPKIVTVVEQEANHNGEGFLERFTEALHYYSTVFDSLDACPVEPDKAALAEMYLQREICNVVCCEGPARLERHEPLAKWRDRLGKAGFRPLHLGFNAYKQASMLLTLFSAEGFCVQENQGSLTLGWHSRPLIAASAWQAAPLRDDETLRFGH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain