SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g31396

Feature Type:gene_model
Chromosome:Gm10
Start:39913162
stop:39914994
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g31396
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G13960AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 4 | chr1:4776622-4779043 FORWARD LENGTH=514 SoyBaseE_val: 3.00E-20ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_Q39658UniRef Annotation by Michelle Graham. Best UniRef hit: SPF1-like DNA-binding protein n=1 Tax=Cucumis sativus RepID=Q39658_CUCSA SoyBaseE_val: 8.00E-20ISS
UniRef100_Q39658UniRef Annotation by Michelle Graham. Most informative UniRef hit: SPF1-like DNA-binding protein n=1 Tax=Cucumis sativus RepID=Q39658_CUCSA SoyBaseE_val: 8.00E-20ISS

Proteins Associated with Glyma10g31396
LocusGene SymbolProtein Name
WRKY130 WRKY Transcription Factor

Expression Patterns of Glyma10g31396
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g31396 not represented in the dataset
Glyma10g31396 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g31396 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g171100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g31396
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g31396
>Glyma10g31396.1   sequence type=CDS   gene model=Glyma10g31396   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTCTCAAATGCTTCTCCTTCTCCAACACAAGTTGATCAACAAAATGATGAGAAAAAAGTGAAGGTTTCATTGTCATTTGATCTTAATTCCAAACCAGAGGAGGAGGAGGAGGAACCAATTTCTTTCTCGGAGGAAGCCCGTGCCAAAGTTGGTGGCGGCTGTGAAACCAGAGGCGCTAGTACTTCCGAACCAGACGATCACATTCAACAAGTTGCTCTTCCTACCGATGCTGCTCACAATCACAGAGTCAACATTGTTGATCCGGAATCTCACTCTCAGAATAGGAAGAGAAAAAGATCTGATAATAGAGGGATGGGAAGCGTTTTCCGTAGGGAAACCTTTGTGTTGCCATTTGAGACCCAAAGTGAGACAGTAATATTTGTGGATGATGGCTATCAGTGGCACCAATATGGACTCAAGACTATGAAGGGAAATTTATTCCCTAGGGTCTACTACAAATGCGCAAGTGCAGGGTGTTGCGCAAGGAAGGAAGTGGACAGAAATTCAGTCAACACAAAACATGTGATTACTACTTATGTTGGTAAACACAATCATGAACCACCCACAAATTAA
Predicted protein sequences of Glyma10g31396
>Glyma10g31396.1   sequence type=predicted peptide   gene model=Glyma10g31396   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDFSNASPSPTQVDQQNDEKKVKVSLSFDLNSKPEEEEEEPISFSEEARAKVGGGCETRGASTSEPDDHIQQVALPTDAAHNHRVNIVDPESHSQNRKRKRSDNRGMGSVFRRETFVLPFETQSETVIFVDDGYQWHQYGLKTMKGNLFPRVYYKCASAGCCARKEVDRNSVNTKHVITTYVGKHNHEPPTN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo