SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g30911

Feature Type:gene_model
Chromosome:Gm10
Start:39507048
stop:39510474
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G08610AT Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR) superfamily protein | chr1:2733788-2735467 REVERSE LENGTH=559 SoyBaseE_val: 8.00E-98ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_G7I6A5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7I6A5_MEDTR SoyBaseE_val: 2.00E-128ISS
UniRef100_I1NIM9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1NIM9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g30911 not represented in the dataset

Glyma10g30911 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma20g36550 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g166300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g30911.1   sequence type=CDS   gene model=Glyma10g30911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGGCTGTTATCCTGATATCGTTACGTATAACTCTCTTGTAAATTTGACTTCTAAACAAGGGAAATATGAGGATACTGCTTTGGTTATATTAAATCTTCTATCCCATGGAATGCAGCCCAATGCTGTGACATACAATACTCTCATTCACTCTCTAATTAACCATGGATATTGGGATGAAGTTGAAGATATTATGAAGATTATGAATGAGACTTCCAGTCCTCCTACACATGTTACTTACAATATTCTGCTAAATGGTTTATGTAAATCTGGACTTTTGGATGTTGCCATAAGCTTCTACAGCACAATGGTTACTGAGAACTGTTCACCAGACATTATAACGTACAATACTCTTCTAAGTGGTTTGTGCAAGGAGGGGTTTATAGATGAGGGCATCCAGTTACTTAACCTATTGGTAGGTACTAGCTCTTCTCCTGGGTTGGTCACCTATAATATTGTAATTGATGGGTTGGCTAGATTGGGATCTATGGAGTCAGCAAAAGAATTGCATGATGAAATGGTGGGCAAAGGAATCATTCCTGATGAAATTACAAACAGTAGTTTGACTTGGGGGTTTTGTTGGGCAGACAAACTTGAGGAAGCTATGGAGCTACTAAAGGAGATGTCTATGAAAGAAAGGATTAAAAATACTGCTTATAGATGTGTAATCCTTGGATTGTGCAGACAAAAGAAGGTTGATATTGCAATTCAAGTTCTAGATTTGATGGTGAAAAGTCAATGCAATCCTGATGAGAGAATATATTCTGCTTTAATTAAAGCTGTTGCTGATGGGGGTATGCTAAAAGAGGATAATGATTTACATCAAACATTGATCAAATGGAAGACTCTGAAAAAGAAATCATTTTGA

>Glyma10g30911.1   sequence type=predicted peptide   gene model=Glyma10g30911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGCYPDIVTYNSLVNLTSKQGKYEDTALVILNLLSHGMQPNAVTYNTLIHSLINHGYWDEVEDIMKIMNETSSPPTHVTYNILLNGLCKSGLLDVAISFYSTMVTENCSPDIITYNTLLSGLCKEGFIDEGIQLLNLLVGTSSSPGLVTYNIVIDGLARLGSMESAKELHDEMVGKGIIPDEITNSSLTWGFCWADKLEEAMELLKEMSMKERIKNTAYRCVILGLCRQKKVDIAIQVLDLMVKSQCNPDERIYSALIKAVADGGMLKEDNDLHQTLIKWKTLKKKSF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo