Glyma10g28680 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g28680

Feature Type:	gene_model
Chromosome:	Gm10
Start:	37532421
stop:	37533401
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g28680

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G09310	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF538 \| chr1:3009109-3009648 FORWARD LENGTH=179	SoyBase	E_val: 7.00E-71	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
PF04398	PFAM	Protein of unknown function, DUF538	JGI		ISS
UniRef100_I1LB31	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LB31_SOYBN	SoyBase	E_val: 3.00E-120	ISS

Expression Patterns of Glyma10g28680

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g28680 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g145900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g28680

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g28680

Limit To All Plant Sequences

>Glyma10g28680.1   sequence type=CDS   gene model=Glyma10g28680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCTAGTGACTGCAGAGATCAAAGCCAAAGCAGAGGTGTATCATGGAGATGAACTCTGCCAAGAGAAGTCAAAGTTGCTGCTAAAGGAGGTAGGGCTACCTAATGGGCTTTTGCCATTGAAGGACATTGAGGAATGTGGGTATGAGAGGGATAGTGGGTTTGTGTGGCTGAAGCAGAAGAAGAGCACAAACCACAAGTTTGAGAAGATTGGGAAGCTGGTTTCCTATGCTCCTGAGATCACTGCCTATGTTGAGGTTGGTAAGATCAAAAAGCTCACTGGTGTGAAAACCAAGGAGCTCTTGGTTTGGATCACACTCAGTGAGATCTTTGTTGATGATCCTCCCACTGGCAAGATCACTTTCAAGACTCCTTCGGGGCTCTTCAGGACATTCCCCGTCTCGGCTTTCGAGATTGAAGAGCCAGTTAAGGAAGTTAAGGAAAAGGAGGAAGAACACAAGGAAGTGAAACAAGTTAAGGAAGAACTCAAGGAAGTTAAACCAGTTGCCAGTGCTGTTGAAGTTCAAGAGGTTTGA

Predicted protein sequences of Glyma10g28680

Limit To All Plant Sequences

>Glyma10g28680.1   sequence type=predicted peptide   gene model=Glyma10g28680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLVTAEIKAKAEVYHGDELCQEKSKLLLKEVGLPNGLLPLKDIEECGYERDSGFVWLKQKKSTNHKFEKIGKLVSYAPEITAYVEVGKIKKLTGVKTKELLVWITLSEIFVDDPPTGKITFKTPSGLFRTFPVSAFEIEEPVKEVKEKEEEHKEVKQVKEELKEVKPVASAVEVQEV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain