Glyma10g28650 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g28650

Feature Type:	gene_model
Chromosome:	Gm10
Start:	37514415
stop:	37515463
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g28650

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G17760	AT	Annotation by Michelle Graham. TAIR10: damaged DNA binding;exodeoxyribonuclease IIIs \| chr4:9871921-9873257 FORWARD LENGTH=250	SoyBase	E_val: 2.00E-44	ISS
GO:0006261	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication	SoyBase	N/A	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003684	GO-mf	Annotation by Michelle Graham. GO Molecular Function: damaged DNA binding	SoyBase	N/A	ISS
GO:0008853	GO-mf	Annotation by Michelle Graham. GO Molecular Function: exodeoxyribonuclease III activity	SoyBase	N/A	ISS
PTHR10870	Panther	RAD1 DNA DAMAGE CHECKPOINT PROTEIN	JGI		ISS
UniRef100_B9SNU5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Rad1 DNA damage checkpoint protein, putative n=1 Tax=Ricinus communis RepID=B9SNU5_RICCO	SoyBase	E_val: 1.00E-49	ISS
UniRef100_I1NEX7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NEX7_SOYBN	SoyBase	E_val: 3.00E-60	ISS

Expression Patterns of Glyma10g28650

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g28650

Paralog	Evidence	Comments
Glyma20g22790	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g28650 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g28650

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g28650

Limit To All Plant Sequences

>Glyma10g28650.1   sequence type=CDS   gene model=Glyma10g28650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTCTTTTTAGATCTGTAGATTCTCTGGATGCCAGTATTTGTGCAGAGATCAGGACAAAGATTCCAGATACAATTGCATGGGACTACAATTTTGAACCTGCAGGGGCAAACCCTTTAACCTTTACTGTTAAATCTGCAGCTCTAAAGGAAGCTATTGAGGATCTTGAATGGCCTGGATCAAGCATCCAGATTATTCTAGAGCCAGAGCTTCCTTCTATAGACTTCATGTATTATGTGAATTCTGAACTCTTGGTGGCATTTCAGTGTACAAATATAAGTTCCTCAGAGCAACAACTTCTAATATGCCTAGCAGTGTTATTAAAGAAAATAGAGGAATTCAGCATCTGGTTTCAATTGCCAAACCATCTGTGTCACACACATGTTGATTCAGTTGGCTATCAGCAACCAGGTAGAATAGCTCATATTGAATTCTTTGTGAAACCAGAGGAA

Predicted protein sequences of Glyma10g28650

Limit To All Plant Sequences

>Glyma10g28650.1   sequence type=predicted peptide   gene model=Glyma10g28650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLFRSVDSLDASICAEIRTKIPDTIAWDYNFEPAGANPLTFTVKSAALKEAIEDLEWPGSSIQIILEPELPSIDFMYYVNSELLVAFQCTNISSSEQQLLICLAVLLKKIEEFSIWFQLPNHLCHTHVDSVGYQQPGRIAHIEFFVKPEE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain