SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g28020

Feature Type:gene_model
Chromosome:Gm10
Start:36811295
stop:36812905
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g28020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G62020AT Annotation by Michelle Graham. TAIR10: germin-like protein 10 | chr3:22971443-22972192 REVERSE LENGTH=220 SoyBaseE_val: 3.00E-102ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0030145GO-mf Annotation by Michelle Graham. GO Molecular Function: manganese ion binding SoyBaseN/AISS
GO:0045735GO-mf Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity SoyBaseN/AISS
PF00190PFAM Cupin JGI ISS
UniRef100_C7S8D1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 17 n=1 Tax=Glycine max RepID=C7S8D1_SOYBN SoyBaseE_val: 1.00E-155ISS
UniRef100_C7S8D1UniRef Annotation by Michelle Graham. Best UniRef hit: Germin-like protein 17 n=1 Tax=Glycine max RepID=C7S8D1_SOYBN SoyBaseE_val: 1.00E-155ISS

Expression Patterns of Glyma10g28020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g28020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g139800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g28020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g28020
>Glyma10g28020.1   sequence type=CDS   gene model=Glyma10g28020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACCAACAAACACTTTTGCAATTTTGGTCTTCTTCTGCTGTGCCATTTCCTTTACCTTCGCTTCTGACCCTGACACACTTCAAGACCTTTGTGTGGCACTTCCCTCTTCAGGTGTGAAGGTGAATGGATTTGCTTGCAAGGCTGAGTCAAATGTAACAGAAGCTGATTTCTTCTTTGCTGGTTTAGCCAAGCCTGGAGCTACCAACAACACATTGGGATCTGTAGTTACTGCAGCCAATGTGGATAAAATTCCAGGACTCAACACATTGGGAGTGTCATTCTCAAGAATAGACTACAAAGCTGGGGGACTTAACCCACCTCACACACACCCTCGAGCCACTGAGATTGTGTTTGTGTTGGATGGACAACTAGATGTTGGATTCATCACCACAGCCAACAAACTCATCTCAAAGTCCATTAATAAGGGTGAAATCTTTGTGTTCCCAAAAGGTTTGGTGCACTATCAGAAGAACAATGGGGATAAGCCTGCTTCTGTGCTTTCTGCCTTCAACAGCCAACTCCCTGGCACAGTGTCTATAGCTGCAACTCTTTTCACTTCAACACCAACTGTGCCTCATAATGTTCTTTCTCAGGCCTTCCAGATTGATGCTAAACTGGTTGATGACATCAAGGCCAAGCTTGCTCCTAAGAAGACTTAA
Predicted protein sequences of Glyma10g28020
>Glyma10g28020.1   sequence type=predicted peptide   gene model=Glyma10g28020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPTNTFAILVFFCCAISFTFASDPDTLQDLCVALPSSGVKVNGFACKAESNVTEADFFFAGLAKPGATNNTLGSVVTAANVDKIPGLNTLGVSFSRIDYKAGGLNPPHTHPRATEIVFVLDGQLDVGFITTANKLISKSINKGEIFVFPKGLVHYQKNNGDKPASVLSAFNSQLPGTVSIAATLFTSTPTVPHNVLSQAFQIDAKLVDDIKAKLAPKKT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo