SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g27881

Feature Type:gene_model
Chromosome:Gm10
Start:36684398
stop:36686368
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G62100AT Annotation by Michelle Graham. TAIR10: indole-3-acetic acid inducible 30 | chr3:22995835-22996593 FORWARD LENGTH=172 SoyBaseE_val: 1.00E-40ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0010262GO-bp Annotation by Michelle Graham. GO Biological Process: somatic embryogenesis SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PF02309PFAM AUX/IAA family JGI ISS
UniRef100_I1JBA2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBA2_SOYBN SoyBaseE_val: 6.00E-109ISS
UniRef100_Q8RVH6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aux/IAA protein n=1 Tax=Populus tremula x Populus tremuloides RepID=Q8RVH6_9ROSI SoyBaseE_val: 1.00E-54ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g27881 not represented in the dataset

Glyma10g27881 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g138500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g27881.1   sequence type=CDS   gene model=Glyma10g27881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAAAGCCTCTAGTTCTTCCTCCTCCTCTATCTCCAGCTGCAGAAACCCTTCCAATTCAACTGCATCCTCTCTCACACACCAACATAGTCAAGACCACCTTCGCACAGATCTTAGGCTTGGACTAAGCCTTTCCGCTACTCAACATGTTGGCTCTTCTAGTTCAGGGGGACACTGGCAACCGATGCAGCCACATCTAATAAGTAGTTTTTCACAAGCTACTGAAGTGAATGATTGCAGCGATCATACCAGCTTCTTTGTGAAGGTGTACATGGAAGGCATTCCGATTGGTAGAAAACTCAACTTGTTAGCTCATGATGGTTATCACGAGTTAGTAAAGACTCTTGAACAGATGTTTGACACTACCATTCTGTGGGGGACTGAAATGGATGGAGTGCAACCAGAGAGATGTCATGTTCTAACTTATGAAGATGGAGAAGGAGATTTGATTATGGTTGGGGATGTCCCTTGGGAGATGTTCTTATCAGCTGTAAAGAGGTTGAAGATCACAAGGGTGGAGGCATTCGGGTGA

>Glyma10g27881.1   sequence type=predicted peptide   gene model=Glyma10g27881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKASSSSSSSISSCRNPSNSTASSLTHQHSQDHLRTDLRLGLSLSATQHVGSSSSGGHWQPMQPHLISSFSQATEVNDCSDHTSFFVKVYMEGIPIGRKLNLLAHDGYHELVKTLEQMFDTTILWGTEMDGVQPERCHVLTYEDGEGDLIMVGDVPWEMFLSAVKRLKITRVEAFG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo