SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g26911): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g26911): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g26911

Feature Type:gene_model
Chromosome:Gm10
Start:35404966
stop:35405983
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G18410AT Annotation by Michelle Graham. TAIR10: transcription activators | chr5:6097456-6104783 REVERSE LENGTH=1282 SoyBaseE_val: 9.00E-40ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0007020GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule nucleation SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0030036GO-bp Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0051225GO-bp Annotation by Michelle Graham. GO Biological Process: spindle assembly SoyBaseN/AISS
GO:0051258GO-bp Annotation by Michelle Graham. GO Biological Process: protein polymerization SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0031209GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SCAR complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR12195Panther P53 INDUCIBLE PROTEIN-RELATED JGI ISS
PF05994PFAM Cytoplasmic Fragile-X interacting family JGI ISS
UniRef100_B7ZGK3UniRef Annotation by Michelle Graham. Most informative UniRef hit: 121F-specific p53 inducible RNA n=1 Tax=Lotus japonicus RepID=B7ZGK3_LOTJA SoyBaseE_val: 6.00E-43ISS
UniRef100_I1NCF6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NCF6_SOYBN SoyBaseE_val: 2.00E-43ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g26911 not represented in the dataset

Glyma10g26911 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g134000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g26911.2   sequence type=transcript   gene model=Glyma10g26911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AACTGCTTGGAAGGATGATTAATTTGCGAAGTTTGATCACTGAACGGATGAACAAGTTTTTCCGTGAAAATATTGAGTTTCTATTTGATCATTTTGAGTGTCAGGATCTGTGTGCCATAGTGGAATTAGAGAAGTTGTTGGATGTCTTAAAATATTCACATGAACTACTGTCTAGAGATCTTTCTGTAGACTCTTTTAGTCTCATGTTGAACGAGATGCAAGAGAACATTTCCCTTGTATCATTTTCTAGTCGACTTGCCTCACAGATTTAGTCTGAGATGCAAAGTGA

>Glyma10g26911.1   sequence type=CDS   gene model=Glyma10g26911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTAATTTGCGAAGTTTGATCACTGAACGGATGAACAAGTTTTTCCGTGAAAATATTGAGTTTCTATTTGATCATTTTGAGTGTCAGGATCTGTGTGCCATAGTGGAATTAGAGAAGTTGTTGGATGTCTTAAAATATTCACATGAACTACTGTCTAGAGATCTTTCTGTAGACTCTTTTAGTCTCATGTTGAACGAGATGCAAGAGAACATTTCCCTTGTATCATTTTCTAGTCGACTTGCCTCACAGGATTACAAGACTCTGCCAAAATCAATTGGGCTTCTTCCTTTCGATGGAGGTGTGATAGTGATGCAATCCTCCCTAGGAAGGGACCAGTCACTAGAGCCATGA

>Glyma10g26911.2   sequence type=CDS   gene model=Glyma10g26911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTAATTTGCGAAGTTTGATCACTGAACGGATGAACAAGTTTTTCCGTGAAAATATTGAGTTTCTATTTGATCATTTTGAGTGTCAGGATCTGTGTGCCATAGTGGAATTAGAGAAGTTGTTGGATGTCTTAAAATATTCACATGAACTACTGTCTAGAGATCTTTCTGTAGACTCTTTTAGTCTCATGTTGAACGAGATGCAAGAGAACATTTCCCTTGTATCATTTTCTAGTCGACTTGCCTCACAGATTTAG

>Glyma10g26911.1   sequence type=predicted peptide   gene model=Glyma10g26911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MINLRSLITERMNKFFRENIEFLFDHFECQDLCAIVELEKLLDVLKYSHELLSRDLSVDSFSLMLNEMQENISLVSFSSRLASQDYKTLPKSIGLLPFDGGVIVMQSSLGRDQSLEP*

>Glyma10g26911.2   sequence type=predicted peptide   gene model=Glyma10g26911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MINLRSLITERMNKFFRENIEFLFDHFECQDLCAIVELEKLLDVLKYSHELLSRDLSVDSFSLMLNEMQENISLVSFSSRLASQI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo