Glyma10g26890 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g26890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g26890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g26890

Feature Type:	gene_model
Chromosome:	Gm10
Start:	35381055
stop:	35383245
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g26890

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G35530	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein S3 family protein \| chr5:13710355-13712192 REVERSE LENGTH=248	SoyBase	E_val: 1.00E-149	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0015935	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3181	KOG	40S ribosomal protein S3	JGI		ISS
PTHR11760	Panther	30S RIBOSOMAL PROTEIN S3	JGI		ISS
PF00189	PFAM	Ribosomal protein S3, C-terminal domain	JGI		ISS
PF07650	PFAM	KH domain	JGI		ISS
UniRef100_G8A1S3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S3 n=1 Tax=Medicago truncatula RepID=G8A1S3_MEDTR	SoyBase	E_val: 4.00E-166	ISS
UniRef100_UPI00018C69B2	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00018C69B2 related cluster n=1 Tax=unknown RepID=UPI00018C69B2	SoyBase	E_val: 3.00E-173	ISS

Expression Patterns of Glyma10g26890

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g26890 not represented in the dataset	Glyma10g26890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g26890 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g133800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g26890

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g26890

Limit To All Plant Sequences

>Glyma10g26890.1   sequence type=CDS   gene model=Glyma10g26890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACCCAAATGAGCAAGAAGAGAAAGTTCGTAGCTGATGGAGTGTTCTTCGCTGAACTGAACGAGGTTCTGACAAGAGAGTTGGCCGAGGACGGTTACTCCGGCGTGGAAGTTAGGGTTACGCCGATGCGCACCGAAATCATAATTAGAGCCACCAGAACCCAAGCTGTTCTCGGTGAGAAGGGAAGGAGAATAAGGGAACTTACCTCTGTGGTTCAGAAGAGGTTCAAGTTTCCCGAGAACAGTGTTGAACTTTATGCTGAAAAGGTCAACAATAGGGGTCTTTGCGCTATTGCTCAGGCTGAGTCTCTTCGCTACAAGCTCCTTGGTGGACTCGCTGTGCGCAGGGCCTGCTATGGTGTTTTGAGGTTTGTTATGGAGAGTGGTGCTAAGGGATGCGAGGTCATTGTGAGTGGAAAATTGAGAGCCCAGAGAGCCAAATCTATGAAGTTTAAGGATGGGTACATGATTTCTTCTGGGCAACCTGTCAAAGATTACATTGACTCTGCAGTGAGACATGTGCTCCTGAGACAGGGTGTTCTTGGCATTAAGGTGAAGATCATGCTTGATTGGGATCCTAAGGGGAAACAGGGTCCTAAAACTCCCCTCCCTGATCTTGTCACAATCCATTCTCCAAAGGAGGAGGAGGAATACATCCGACCTGCCCCAGTTTTGGCTGCTAATAATGATATTGAGGTCCCTGTCCCTGTCGCATGA

Predicted protein sequences of Glyma10g26890

Limit To All Plant Sequences

>Glyma10g26890.1   sequence type=predicted peptide   gene model=Glyma10g26890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATQMSKKRKFVADGVFFAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELTSVVQKRFKFPENSVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHSPKEEEEYIRPAPVLAANNDIEVPVPVA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain