SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g26890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g26890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g26890

Feature Type:gene_model
Chromosome:Gm10
Start:35381055
stop:35383245
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G35530AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S3 family protein | chr5:13710355-13712192 REVERSE LENGTH=248 SoyBaseE_val: 1.00E-149ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3181 KOG 40S ribosomal protein S3 JGI ISS
PTHR11760Panther 30S RIBOSOMAL PROTEIN S3 JGI ISS
PF00189PFAM Ribosomal protein S3, C-terminal domain JGI ISS
PF07650PFAM KH domain JGI ISS
UniRef100_G8A1S3UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S3 n=1 Tax=Medicago truncatula RepID=G8A1S3_MEDTR SoyBaseE_val: 4.00E-166ISS
UniRef100_UPI00018C69B2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C69B2 related cluster n=1 Tax=unknown RepID=UPI00018C69B2 SoyBaseE_val: 3.00E-173ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g26890 not represented in the dataset

Glyma10g26890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g133800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g26890.1   sequence type=CDS   gene model=Glyma10g26890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACCCAAATGAGCAAGAAGAGAAAGTTCGTAGCTGATGGAGTGTTCTTCGCTGAACTGAACGAGGTTCTGACAAGAGAGTTGGCCGAGGACGGTTACTCCGGCGTGGAAGTTAGGGTTACGCCGATGCGCACCGAAATCATAATTAGAGCCACCAGAACCCAAGCTGTTCTCGGTGAGAAGGGAAGGAGAATAAGGGAACTTACCTCTGTGGTTCAGAAGAGGTTCAAGTTTCCCGAGAACAGTGTTGAACTTTATGCTGAAAAGGTCAACAATAGGGGTCTTTGCGCTATTGCTCAGGCTGAGTCTCTTCGCTACAAGCTCCTTGGTGGACTCGCTGTGCGCAGGGCCTGCTATGGTGTTTTGAGGTTTGTTATGGAGAGTGGTGCTAAGGGATGCGAGGTCATTGTGAGTGGAAAATTGAGAGCCCAGAGAGCCAAATCTATGAAGTTTAAGGATGGGTACATGATTTCTTCTGGGCAACCTGTCAAAGATTACATTGACTCTGCAGTGAGACATGTGCTCCTGAGACAGGGTGTTCTTGGCATTAAGGTGAAGATCATGCTTGATTGGGATCCTAAGGGGAAACAGGGTCCTAAAACTCCCCTCCCTGATCTTGTCACAATCCATTCTCCAAAGGAGGAGGAGGAATACATCCGACCTGCCCCAGTTTTGGCTGCTAATAATGATATTGAGGTCCCTGTCCCTGTCGCATGA

>Glyma10g26890.1   sequence type=predicted peptide   gene model=Glyma10g26890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATQMSKKRKFVADGVFFAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELTSVVQKRFKFPENSVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHSPKEEEEYIRPAPVLAANNDIEVPVPVA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo