Glyma10g26860 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g26860

Feature Type:	gene_model
Chromosome:	Gm10
Start:	35322381
stop:	35322719
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g26860

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G57420	AT	Annotation by Michelle Graham. TAIR10: indole-3-acetic acid inducible 33 \| chr5:23270024-23270959 FORWARD LENGTH=171	SoyBase	E_val: 4.00E-17	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
PF02309	PFAM	AUX/IAA family	JGI		ISS
UniRef100_G7JVF2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Indole-3-acetic acid inducible n=1 Tax=Medicago truncatula RepID=G7JVF2_MEDTR	SoyBase	E_val: 7.00E-20	ISS
UniRef100_I1LAQ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LAQ2_SOYBN	SoyBase	E_val: 2.00E-45	ISS

Expression Patterns of Glyma10g26860

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g26860 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g133600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g26860

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g26860

Limit To All Plant Sequences

>Glyma10g26860.2   sequence type=CDS   gene model=Glyma10g26860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCACCTTCAACTTCTTCGTTGGCTTTCTATGTTGGTAGCAACGAATACAATTGTAGCAACAAATTCAAAGGGTTCCTTGGACTTGAAAATGATGATCTTGTCTCCATTGTGGTTCCTACAATGACATGCATAAGCCTCCATAACCATGGTAACTACCAAAGCCTTATGAAGGCCCTACGCCAAATGTTTGTGGATGATGATGATGTTGGAGACAATACTAGTGATGATAATCTTGACCTCTCCAATGTCATTCTTGGTCACCTTATTGTCTATGAAGACATGGAGAATGATCTTTTTCTAGGCTGGTGA

Predicted protein sequences of Glyma10g26860

Limit To All Plant Sequences

>Glyma10g26860.2   sequence type=predicted peptide   gene model=Glyma10g26860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
APSTSSLAFYVGSNEYNCSNKFKGFLGLENDDLVSIVVPTMTCISLHNHGNYQSLMKALRQMFVDDDDVGDNTSDDNLDLSNVILGHLIVYEDMENDLFLGW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain