SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g26860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g26860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g26860

Feature Type:gene_model
Chromosome:Gm10
Start:35322381
stop:35322719
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g26860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57420AT Annotation by Michelle Graham. TAIR10: indole-3-acetic acid inducible 33 | chr5:23270024-23270959 FORWARD LENGTH=171 SoyBaseE_val: 4.00E-17ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PF02309PFAM AUX/IAA family JGI ISS
UniRef100_G7JVF2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Indole-3-acetic acid inducible n=1 Tax=Medicago truncatula RepID=G7JVF2_MEDTR SoyBaseE_val: 7.00E-20ISS
UniRef100_I1LAQ2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LAQ2_SOYBN SoyBaseE_val: 2.00E-45ISS

Expression Patterns of Glyma10g26860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g26860 not represented in the dataset
Glyma10g26860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g26860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g133600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g26860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g26860
>Glyma10g26860.2   sequence type=CDS   gene model=Glyma10g26860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCACCTTCAACTTCTTCGTTGGCTTTCTATGTTGGTAGCAACGAATACAATTGTAGCAACAAATTCAAAGGGTTCCTTGGACTTGAAAATGATGATCTTGTCTCCATTGTGGTTCCTACAATGACATGCATAAGCCTCCATAACCATGGTAACTACCAAAGCCTTATGAAGGCCCTACGCCAAATGTTTGTGGATGATGATGATGTTGGAGACAATACTAGTGATGATAATCTTGACCTCTCCAATGTCATTCTTGGTCACCTTATTGTCTATGAAGACATGGAGAATGATCTTTTTCTAGGCTGGTGA
Predicted protein sequences of Glyma10g26860
>Glyma10g26860.2   sequence type=predicted peptide   gene model=Glyma10g26860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
APSTSSLAFYVGSNEYNCSNKFKGFLGLENDDLVSIVVPTMTCISLHNHGNYQSLMKALRQMFVDDDDVGDNTSDDNLDLSNVILGHLIVYEDMENDLFLGW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo