Report for Sequence Feature Glyma10g26860
Feature Type: gene_model
Chromosome: Gm10
Start: 35322381
stop: 35322719
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g26860
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G57420 AT
Annotation by Michelle Graham. TAIR10: indole-3-acetic acid inducible 33 | chr5:23270024-23270959 FORWARD LENGTH=171
SoyBase E_val: 4.00E-17 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009733 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0046983 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity
SoyBase N/A ISS
PF02309 PFAM
AUX/IAA family
JGI ISS
UniRef100_G7JVF2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Indole-3-acetic acid inducible n=1 Tax=Medicago truncatula RepID=G7JVF2_MEDTR
SoyBase E_val: 7.00E-20 ISS
UniRef100_I1LAQ2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LAQ2_SOYBN
SoyBase E_val: 2.00E-45 ISS
Expression Patterns of Glyma10g26860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma10g26860 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g133600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g26860
Coding sequences of Glyma10g26860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g26860.2 sequence type=CDS gene model=Glyma10g26860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GCACCTTCAACTTCTTCGTTGGCTTTCTATGTTGGTAGCAACGAATACAATTGTAGCAACAAATTCAAAGGGTTCCTTGGACTTGAAAATGATGATCTTGTCTCCATTGTGGTTCCTACAATGACATGCATAAGCCTCCATAACCATGGTAACTACCAAAGCCTTATGAAGGCCCTACGCCAAATGTTTGTGGATGATGATGATGTTGGAGACAATACTAGTGATGATAATCTTGACCTCTCCAATGTCATTCTTGGTCACCTTATTGTCTATGAAGACATGGAGAATGATCTTTTTCTAGGCTGGTGA
Predicted protein sequences of Glyma10g26860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g26860.2 sequence type=predicted peptide gene model=Glyma10g26860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
APSTSSLAFYVGSNEYNCSNKFKGFLGLENDDLVSIVVPTMTCISLHNHGNYQSLMKALRQMFVDDDDVGDNTSDDNLDLSNVILGHLIVYEDMENDLFLGW*