SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g26790

Feature Type:gene_model
Chromosome:Gm10
Start:35258429
stop:35260485
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g26790
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G35530AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S3 family protein | chr5:13710355-13712192 REVERSE LENGTH=248 SoyBaseE_val: 6.00E-150ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3181 KOG 40S ribosomal protein S3 JGI ISS
PTHR11760Panther 30S RIBOSOMAL PROTEIN S3 JGI ISS
PF00189PFAM Ribosomal protein S3, C-terminal domain JGI ISS
PF07650PFAM KH domain JGI ISS
UniRef100_G8A1S3UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S3 n=1 Tax=Medicago truncatula RepID=G8A1S3_MEDTR SoyBaseE_val: 3.00E-164ISS
UniRef100_UPI00018C69B3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C69B3 related cluster n=1 Tax=unknown RepID=UPI00018C69B3 SoyBaseE_val: 3.00E-171ISS

Expression Patterns of Glyma10g26790
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g26790
ParalogEvidenceComments
Glyma20g21190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g26790 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g133100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g26790
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g26790
>Glyma10g26790.1   sequence type=CDS   gene model=Glyma10g26790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACCCAAATGAGCAAGAAGAGAAAGTTCGTAGCTGATGGAGTGTTCTTCGCTGAACTGAACGAGGTTCTGACAAGAGAGTTGGCCGAGGACGGTTACTCCGGCGTGGAAGTTAGGGTTACGCCGATGCGCACCGAAATCATAATTAGAGCCACCAGAACCCAAGCTGTTCTCGGTGAGAAGGGAAGGAGAATAAGGGAACTTACCTCTGTGGTTCAGAAGAGGTTCAAGTTTCCCGAGAACAGTGTCGAACTTTATGCTGAAAAGGTCAACAATAGGGGTCTTTGCGCTATTGCTCAGGCTGAGTCTCTTCGATACAAGCTCCTTGGTGGACTCGCTGTGCGCAGGGCCTGCTATGGTGTTTTGAGGTTTGTTATGGAGAGTGGTGCTAAGGGATGCGAGGTCATTGTGAGTGGAAAATTGAGAGCCCAGAGAGCCAAATCTATGAAGTTTAAGGATGGGTACATGATTTCTTCTGGGCAACCTGTCAAAGATTACATTGACTCTGCAGTGAGACATGTGCTCCTGAGACAGGGTGTTCTTGGCATTAAGGTGAAGATCATGCTTGATTGGGATCCTAAGGGGAAACAGGGTCCTAAAACTCCCCTCCCTGATCTTGTCACAATCCATTCTCCAAAGGAGGAAGAAGAATACATCCAGCCTGCTCCAGTTTTGGCTGCTAATGATATTGAGGTCCCTGTTGCTTGA
Predicted protein sequences of Glyma10g26790
>Glyma10g26790.1   sequence type=predicted peptide   gene model=Glyma10g26790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATQMSKKRKFVADGVFFAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELTSVVQKRFKFPENSVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHSPKEEEEYIQPAPVLAANDIEVPVA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo