SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g26440

Feature Type:gene_model
Chromosome:Gm10
Start:34809660
stop:34810680
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g26440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G13560AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant protein (LEA) family protein | chr4:7879764-7880311 REVERSE LENGTH=109 SoyBaseE_val: 6.00E-19ISS
GO:0009567GO-bp Annotation by Michelle Graham. GO Biological Process: double fertilization forming a zygote and endosperm SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7I791UniRef Annotation by Michelle Graham. Most informative UniRef hit: Late embryogenesis abundant protein n=1 Tax=Medicago truncatula RepID=G7I791_MEDTR SoyBaseE_val: 2.00E-29ISS
UniRef100_I1LAN8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LAN8_SOYBN SoyBaseE_val: 7.00E-53ISS

Expression Patterns of Glyma10g26440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g26440
ParalogEvidenceComments
Glyma20g20880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g26440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g130600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g26440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g26440
>Glyma10g26440.1   sequence type=CDS   gene model=Glyma10g26440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAAGTGCCCAGCAAAACTTCAATGCAGGCCAAACCCAAGGCCAGACTCAGGTTAAGGCCGAAGAATTTGTCCAATCCACAAAGGAAACAGCTTCGGCAGCTACTGACAAGGCTAATGCAGCTGCTAACACAACAGGGCAAACTGCTCAACAAAACAAGGATGAATCTGCTGGTTTTCTCCAACAGACTGGGGAACAAGTGAAGAACATGGCTCAAGGTGCTGTGGATAGTGTGAAGCACACACTCGGGATGGACAAGAAGTGA
Predicted protein sequences of Glyma10g26440
>Glyma10g26440.1   sequence type=predicted peptide   gene model=Glyma10g26440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSAQQNFNAGQTQGQTQVKAEEFVQSTKETASAATDKANAAANTTGQTAQQNKDESAGFLQQTGEQVKNMAQGAVDSVKHTLGMDKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo