SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g25531

Feature Type:gene_model
Chromosome:Gm10
Start:33429232
stop:33436184
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11720AT Annotation by Michelle Graham. TAIR10: starch synthase 3 | chr1:3952460-3956840 FORWARD LENGTH=1042 SoyBaseE_val: 9.00E-27ISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009250GO-bp Annotation by Michelle Graham. GO Biological Process: glucan biosynthetic process SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009011GO-mf Annotation by Michelle Graham. GO Molecular Function: starch synthase activity SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:2001070GO-mf Annotation by Michelle Graham. GO Molecular Function: starch binding SoyBaseN/AISS
PTHR12526Panther GLYCOSYLTRANSFERASE JGI ISS
PTHR12526:SF17Panther STARCH SYNTHASE JGI ISS
UniRef100_A4F2M4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Starch synthase III n=1 Tax=Phaseolus vulgaris RepID=A4F2M4_PHAVU SoyBaseE_val: 5.00E-26ISS
UniRef100_I1M0Z8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M0Z8_SOYBN SoyBaseE_val: 2.00E-26ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g25531 not represented in the dataset

Glyma10g25531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g127300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g25531.1   sequence type=CDS   gene model=Glyma10g25531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATATGCTGACAAAGCTACAACTGTCTCTCCCACGTACTCAAGAGAGATTGCAGGTAATACCGTAATTGCTTCTCATCTTCCCAAGTTCCATGGTATAATAAATGGAATCGACCCAGATATATGGGACCCATATAATAATAAATTCATTCCTGTAGAATTTACTACTTCCTATGGATCAGCAGCCACTGGTAGTGGTAGTGGCAGCGGCAGTGCTGGTAGTGGTTACAACACTGTTCAGCCATCACCACCTACTACTAATCAAATTCAACAATCAGCACAGCCTTGA

>Glyma10g25531.1   sequence type=predicted peptide   gene model=Glyma10g25531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAYADKATTVSPTYSREIAGNTVIASHLPKFHGIINGIDPDIWDPYNNKFIPVEFTTSYGSAATGSGSGSGSAGSGYNTVQPSPPTTNQIQQSAQP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo