SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g25406

Feature Type:gene_model
Chromosome:Gm10
Start:33228101
stop:33230822
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G64560AT Annotation by Michelle Graham. TAIR10: magnesium transporter 9 | chr5:25807163-25809395 REVERSE LENGTH=378 SoyBaseE_val: 1.00E-70ISS
GO:0030001GO-bp Annotation by Michelle Graham. GO Biological Process: metal ion transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015095GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion transmembrane transporter activity SoyBaseN/AISS
GO:0046873GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion transmembrane transporter activity SoyBaseN/AISS
PTHR13890Panther RNA SPLICING PROTEIN MRS2, MITOCHONDRIAL JGI ISS
UniRef100_G7I479UniRef Annotation by Michelle Graham. Most informative UniRef hit: Magnesium transporter n=1 Tax=Medicago truncatula RepID=G7I479_MEDTR SoyBaseE_val: 3.00E-85ISS
UniRef100_UPI000233C90CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C90C related cluster n=1 Tax=unknown RepID=UPI000233C90C SoyBaseE_val: 4.00E-124ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g25406 not represented in the dataset

Glyma10g25406 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g126500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g25406.1   sequence type=CDS   gene model=Glyma10g25406   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCACTGTAGTGCATTTAAGACATTGAAAACCAGTACTGAGGGGAAATTTCATAACAATACACCATGGTGGATTGAAGTGAAGGTATTGCTGAGAGATCCAACAGATGAAAATGTGATCCATATTGTTGAGGAACTGCAAAGGCGGTTGCCTCGATTGAGTGCCACCGGTCTTCAACAACAAGGAGATGGTAAAGAGTATCTTGGTGGCCAAAATGATGTTGAAGCCGCTGAAGAAGATGAGTCACCCTTTGAATTTCAGGCCCTGGAGGTTGCTTTGGAAGCCATTTGTAGTTTTCTTGCTGCATGTACAATAGAATTGGAGATGGCTGCTTATCCTGCATTAGATGAATTTACCTCCAAGATTAGTAGTTGTAATTTGGACAGAGTTCGTAAATTGAAGAGTGCAATGACAAGGCTGACTGTTAGGGTTCAAAAGGTATTCAGAGATGAGCTTGAACAATTGTTGGATGATGATGATGATATGGCTGACCTGTACCTGTCAAGAAAGGCTGGTTCAGCATCACCGGTTAGTGGATCAGGTGCTGCAAATTGGTTTGCTGCCTCCCCCACCATAGGATCAAAGATATCTAGAGCAAGTTTAGCAACTGTTTGTTTAGATGAAAATGATGTGGAAGAGCTTGAAATGTTACTTGAGCTTATTTCAGTGAAATCGACCACACATTGA

>Glyma10g25406.1   sequence type=predicted peptide   gene model=Glyma10g25406   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFHCSAFKTLKTSTEGKFHNNTPWWIEVKVLLRDPTDENVIHIVEELQRRLPRLSATGLQQQGDGKEYLGGQNDVEAAEEDESPFEFQALEVALEAICSFLAACTIELEMAAYPALDEFTSKISSCNLDRVRKLKSAMTRLTVRVQKVFRDELEQLLDDDDDMADLYLSRKAGSASPVSGSGAANWFAASPTIGSKISRASLATVCLDENDVEELEMLLELISVKSTTH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo