SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g25246

Feature Type:gene_model
Chromosome:Gm10
Start:33017815
stop:33019566
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g25246
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30510AT Annotation by Michelle Graham. TAIR10: homolog of yeast autophagy 18 (ATG18) B | chr4:14905664-14906915 REVERSE LENGTH=248 SoyBaseE_val: 5.00E-33ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0016236GO-bp Annotation by Michelle Graham. GO Biological Process: macroautophagy SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0070772GO-cc Annotation by Michelle Graham. GO Cellular Compartment: PAS complex SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
GO:0080025GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-3,5-bisphosphate binding SoyBaseN/AISS
PTHR11227Panther WD-REPEAT PROTEIN INTERACTING WITH PHOSPHOINOSIDES (WIPI)-RELATED JGI ISS
PTHR11227:SF17Panther gb def: f41e6.13.p [caenorhabditis elegans] JGI ISS
UniRef100_B9T6W4UniRef Annotation by Michelle Graham. Most informative UniRef hit: WD-repeat protein, putative n=1 Tax=Ricinus communis RepID=B9T6W4_RICCO SoyBaseE_val: 1.00E-54ISS
UniRef100_UPI000233C909UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C909 related cluster n=1 Tax=unknown RepID=UPI000233C909 SoyBaseE_val: 6.00E-92ISS

Expression Patterns of Glyma10g25246
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g25246 not represented in the dataset
Glyma10g25246 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g25246 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g126200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g25246
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g25246
>Glyma10g25246.1   sequence type=CDS   gene model=Glyma10g25246   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAACCATTCTTCTTTGCCATCTTTACTTTGCGCTTCTTTCAACCAAGACCATAGTTACTTTGTCGTTGGCACCAAAGATGGTGTTAGAATATTTGATACCAATACAGGAAGACTTTGTTATCAAAAGATAAAATTCACAGTTAGAGCTTTTGTTATTGCTGAGATGTTGTTTAGCTCCAGTCTTCTTGCTATCATCAGAGCCGGTGATCAACCATCTTTGTCCCCTTGCCGTCTTTGTTTATTCAATACAACCACTGGAGCTGCTATTAGAGAATTGAATTTTTTAACTTCCATACTTGATGTTTGCATGAATAGACAAAGACTCATTGTCATTTTACAAGACAAAGCATATGCATATGAAATAAATAGTCTCATAATCTTGGATACTATTGACACAATGCCAAATATTAAAGGTGAGGCTGGAACCAATACCTGA
Predicted protein sequences of Glyma10g25246
>Glyma10g25246.1   sequence type=predicted peptide   gene model=Glyma10g25246   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANHSSLPSLLCASFNQDHSYFVVGTKDGVRIFDTNTGRLCYQKIKFTVRAFVIAEMLFSSSLLAIIRAGDQPSLSPCRLCLFNTTTGAAIRELNFLTSILDVCMNRQRLIVILQDKAYAYEINSLIILDTIDTMPNIKGEAGTNT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo