Glyma10g25246 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g25246): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g25246): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g25246

Feature Type:	gene_model
Chromosome:	Gm10
Start:	33017815
stop:	33019566
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g25246

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G30510	AT	Annotation by Michelle Graham. TAIR10: homolog of yeast autophagy 18 (ATG18) B \| chr4:14905664-14906915 REVERSE LENGTH=248	SoyBase	E_val: 5.00E-33	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0016236	GO-bp	Annotation by Michelle Graham. GO Biological Process: macroautophagy	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0070772	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: PAS complex	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
GO:0080025	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-3,5-bisphosphate binding	SoyBase	N/A	ISS
PTHR11227	Panther	WD-REPEAT PROTEIN INTERACTING WITH PHOSPHOINOSIDES (WIPI)-RELATED	JGI		ISS
PTHR11227:SF17	Panther	gb def: f41e6.13.p [caenorhabditis elegans]	JGI		ISS
UniRef100_B9T6W4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: WD-repeat protein, putative n=1 Tax=Ricinus communis RepID=B9T6W4_RICCO	SoyBase	E_val: 1.00E-54	ISS
UniRef100_UPI000233C909	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C909 related cluster n=1 Tax=unknown RepID=UPI000233C909	SoyBase	E_val: 6.00E-92	ISS

Expression Patterns of Glyma10g25246

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g25246 not represented in the dataset	Glyma10g25246 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g25246 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g126200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g25246

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g25246

Limit To All Plant Sequences

>Glyma10g25246.1   sequence type=CDS   gene model=Glyma10g25246   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAACCATTCTTCTTTGCCATCTTTACTTTGCGCTTCTTTCAACCAAGACCATAGTTACTTTGTCGTTGGCACCAAAGATGGTGTTAGAATATTTGATACCAATACAGGAAGACTTTGTTATCAAAAGATAAAATTCACAGTTAGAGCTTTTGTTATTGCTGAGATGTTGTTTAGCTCCAGTCTTCTTGCTATCATCAGAGCCGGTGATCAACCATCTTTGTCCCCTTGCCGTCTTTGTTTATTCAATACAACCACTGGAGCTGCTATTAGAGAATTGAATTTTTTAACTTCCATACTTGATGTTTGCATGAATAGACAAAGACTCATTGTCATTTTACAAGACAAAGCATATGCATATGAAATAAATAGTCTCATAATCTTGGATACTATTGACACAATGCCAAATATTAAAGGTGAGGCTGGAACCAATACCTGA

Predicted protein sequences of Glyma10g25246

Limit To All Plant Sequences

>Glyma10g25246.1   sequence type=predicted peptide   gene model=Glyma10g25246   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANHSSLPSLLCASFNQDHSYFVVGTKDGVRIFDTNTGRLCYQKIKFTVRAFVIAEMLFSSSLLAIIRAGDQPSLSPCRLCLFNTTTGAAIRELNFLTSILDVCMNRQRLIVILQDKAYAYEINSLIILDTIDTMPNIKGEAGTNT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain