Glyma10g24760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g24760

Feature Type:	gene_model
Chromosome:	Gm10
Start:	32519041
stop:	32520500
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g24760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G62120	AT	Annotation by Michelle Graham. TAIR10: Class II aaRS and biotin synthetases superfamily protein \| chr3:23001227-23003849 REVERSE LENGTH=530	SoyBase	E_val: 5.00E-85	ISS
GO:0006418	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation	SoyBase	N/A	ISS
GO:0006433	GO-bp	Annotation by Michelle Graham. GO Biological Process: prolyl-tRNA aminoacylation	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0004812	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity	SoyBase	N/A	ISS
GO:0004827	GO-mf	Annotation by Michelle Graham. GO Molecular Function: proline-tRNA ligase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
PTHR11451	Panther	TRNA SYNTHETASE-RELATED	JGI		ISS
PTHR11451:SF6	Panther	PROLYL-TRNA SYNTHETASE	JGI		ISS
UniRef100_Q016X8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Multifunctional aminoacyl-tRNA ligase-like protein (ISS) (Fragment) n=1 Tax=Ostreococcus tauri RepID=Q016X8_OSTTA	SoyBase	E_val: 1.00E-66	ISS
UniRef100_Q016X8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Multifunctional aminoacyl-tRNA ligase-like protein (ISS) (Fragment) n=1 Tax=Ostreococcus tauri RepID=Q016X8_OSTTA	SoyBase	E_val: 1.00E-66	ISS

Expression Patterns of Glyma10g24760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g24760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g24760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g24760

Limit To All Plant Sequences

>Glyma10g24760.1   sequence type=CDS   gene model=Glyma10g24760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGAGTGTTTTGGTTGACTTTGGATTTGGATTAATTTGGCAGGTTGTTGTTAATACGGAAATGGTTGAGTACTATGATATTTCCAGTTGCTATATTCTGAGGCCTTGGTCAATGGCAATATGGGAGATCATGCAATTTTTCGATCCAGAAGTAAAGAAAATGAAAATCAAGACCTGCTACTTCCCATTGTTTGTATCTCCTGAAATTCTGCAAAAGGAGAAGGACCACGTTGAGGATTTTGCTCCTGAGGTGAAAGTTTGTGAATCTGTTGGGCCATGTAATGTTGACTATTCAATAAAGGTCATGCGTTCTTGTCCTGGTAACAGCCTCTCTGCTTGCAAGGGTAAGGCTAAAAAAATCTATCCCCCAAGACTAAAAAAATCTATGCCCTGCTTGTTTCCATTGTGTGGTGCTTATAGAAGTTTTGATTTCAGGAGTCGTCAGTTTCTTTGGCAAGAAAGACACACTGCTTTTGCAACAAAGGATGAAGCAGATGCAGAGGTTTTTGAGATTCTGGAATTATATAGGCGTATATACGAAGAGTATTTGGCGGTGTTGAGTTATGTTATTTTAATGGCGTTTATTCCAAACACTGGTCGTGGTATCCAAGGTGCAACTTCTTATTGTTTGGGCCAAAATTTTGCTAAAATGTTTGAGATAAACTTTGAAAATGAAAAGGGAGAGAAAGCAATGGTCTGGAAAAGTTCATGGGCCTATAGTACTCAAACT

Predicted protein sequences of Glyma10g24760

Limit To All Plant Sequences

>Glyma10g24760.1   sequence type=predicted peptide   gene model=Glyma10g24760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VSVLVDFGFGLIWQVVVNTEMVEYYDISSCYILRPWSMAIWEIMQFFDPEVKKMKIKTCYFPLFVSPEILQKEKDHVEDFAPEVKVCESVGPCNVDYSIKVMRSCPGNSLSACKGKAKKIYPPRLKKSMPCLFPLCGAYRSFDFRSRQFLWQERHTAFATKDEADAEVFEILELYRRIYEEYLAVLSYVILMAFIPNTGRGIQGATSYCLGQNFAKMFEINFENEKGEKAMVWKSSWAYSTQT

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain