SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g24682): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g24682): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g24682

Feature Type:gene_model
Chromosome:Gm10
Start:32385218
stop:32386330
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G68010AT Annotation by Michelle Graham. TAIR10: hydroxypyruvate reductase | chr1:25493418-25495720 FORWARD LENGTH=386 SoyBaseE_val: 1.00E-64ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0009854GO-bp Annotation by Michelle Graham. GO Biological Process: oxidative photosynthetic carbon pathway SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010304GO-bp Annotation by Michelle Graham. GO Biological Process: PSII associated light-harvesting complex II catabolic process SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0071482GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to light stimulus SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0008266GO-mf Annotation by Michelle Graham. GO Molecular Function: poly(U) RNA binding SoyBaseN/AISS
GO:0008465GO-mf Annotation by Michelle Graham. GO Molecular Function: glycerate dehydrogenase activity SoyBaseN/AISS
PTHR10996Panther 2-HYDROXYACID DEHYDROGENASE JGI ISS
PTHR10996:SF22Panther ERYTHRONATE-4-PHOSPHATE DEHYDROGENASE JGI ISS
PF02826PFAM D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain JGI ISS
UniRef100_B0M1A3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal hydroxypyruvate reductase n=1 Tax=Glycine max RepID=B0M1A3_SOYBN SoyBaseE_val: 5.00E-70ISS
UniRef100_UPI000233C7ACUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C7AC related cluster n=1 Tax=unknown RepID=UPI000233C7AC SoyBaseE_val: 2.00E-81ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g24682 not represented in the dataset

Glyma10g24682 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g24682.1   sequence type=CDS   gene model=Glyma10g24682   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAGGAAGCAATTCTTATAAACTGCAGCAGAGGACCTGTTATTGATGAAGCTGCACTTGTGGAGCATTTAAAACAGAACCCGATGTTTCGAGTAGGCCTTGATGTGTTTGAGGAAGAGCCCTACATGAAATCCAGGCTTACAGAGTTGAAGAATGCCATTGTGGTACCCCACATTGCATCTGCCTCCAACTGGACTCATGAGGGAATGGCTACACTAGCAGCTCTAAACGTGTTAGGGAAGATCAAAGGGTACCCAGTTTGGTTTGATGCCAATAGGGTGGAAGCATTCCTCAAAGAGAATGCTCGACCACCAGCTACATGCCCAAGCATTGTTAATGCAAAAGCCCTAGGTAATAACATTTTATACACTTGA

>Glyma10g24682.1   sequence type=predicted peptide   gene model=Glyma10g24682   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKEAILINCSRGPVIDEAALVEHLKQNPMFRVGLDVFEEEPYMKSRLTELKNAIVVPHIASASNWTHEGMATLAALNVLGKIKGYPVWFDANRVEAFLKENARPPATCPSIVNAKALGNNILYT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo