Glyma10g24492 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g24492): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g24492): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g24492

Feature Type:	gene_model
Chromosome:	Gm10
Start:	31920804
stop:	31923348
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g24492

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G06600	AT	Annotation by Michelle Graham. TAIR10: ubiquitin-specific protease 12 \| chr5:2020682-2027834 REVERSE LENGTH=985	SoyBase	E_val: 9.00E-17	ISS
GO:0006007	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucose catabolic process	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004221	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin thiolesterase activity	SoyBase	N/A	ISS
GO:0004843	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-specific protease activity	SoyBase	N/A	ISS
PTHR24619	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24619:SF162	Panther		JGI		ISS
PF00443	PFAM	Ubiquitin carboxyl-terminal hydrolase	JGI		ISS
UniRef100_C5Y4X8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein Sb05g022390 n=1 Tax=Sorghum bicolor RepID=C5Y4X8_SORBI	SoyBase	E_val: 1.00E-14	ISS
UniRef100_G7J6M7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin carboxyl-terminal hydrolase family protein n=1 Tax=Medicago truncatula RepID=G7J6M7_MEDTR	SoyBase	E_val: 2.00E-14	ISS

Expression Patterns of Glyma10g24492

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g24492 not represented in the dataset	Glyma10g24492 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g24492 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g123900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g24492

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g24492

Limit To All Plant Sequences

>Glyma10g24492.1   sequence type=CDS   gene model=Glyma10g24492   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACCCGCGAGTCACGTGTCGCCCTTCTGCCGAAGGCGTTTTGGTTCACAATGGTGGTGTGCATAGTGGACATTATTATGCTTTTATCAGGTCGACTCTATCTGAGCAGTGGTATAAATTTGATGATGAGAGGGTGACTAAAGAAAACTATTGTACAAATGCTGCTGACTGGAAAAAAAATTCAAAATACGATAGAAATCAACAAGTATAA

Predicted protein sequences of Glyma10g24492

Limit To All Plant Sequences

>Glyma10g24492.1   sequence type=predicted peptide   gene model=Glyma10g24492   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHPRVTCRPSAEGVLVHNGGVHSGHYYAFIRSTLSEQWYKFDDERVTKENYCTNAADWKKNSKYDRNQQV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain