Glyma10g23690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g23690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g23690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g23690

Feature Type:	gene_model
Chromosome:	Gm10
Start:	30155803
stop:	30157004
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g23690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G18280	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr3:6267102-6267392 FORWARD LENGTH=96	SoyBase	E_val: 5.00E-19	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0009963	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
UniRef100_B7FM99	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Medicago truncatula RepID=B7FM99_MEDTR	SoyBase	E_val: 4.00E-17	ISS
UniRef100_I1LAG3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LAG3_SOYBN	SoyBase	E_val: 7.00E-69	ISS

Expression Patterns of Glyma10g23690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g23690 not represented in the dataset	Glyma10g23690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g23690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g121000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g23690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g23690

Limit To All Plant Sequences

>Glyma10g23690.1   sequence type=CDS   gene model=Glyma10g23690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATTCAATGTGTGATGCTGTGCATTATGCTTCTTAGTCTTTTTCTAATTGAAGCAGACGTGTCAGCACCAGCACCAGCACCAGCACCAGCACCAGCTCCAGTGGCAGAGTGTTGCAACGTAATGGAGTTGGTTCCATGTGCTGCTGCCTTCACCACCTCAACCCCGCCCTCACCAGAGTGCTGTCAAAGACTCAGAGAGCAACCAAGATCATGCATTTGCCAGTACATGAAAGACCCAACACTTGAGAAGTTCATCAACACTTCCAATGCCAAGATGGTTAGTGACAGTTGTGGCTCCCCAATGCCAACCAATTGCTGA

Predicted protein sequences of Glyma10g23690

Limit To All Plant Sequences

>Glyma10g23690.1   sequence type=predicted peptide   gene model=Glyma10g23690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKIQCVMLCIMLLSLFLIEADVSAPAPAPAPAPAPVAECCNVMELVPCAAAFTTSTPPSPECCQRLREQPRSCICQYMKDPTLEKFINTSNAKMVSDSCGSPMPTNC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain