SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g23581

Feature Type:gene_model
Chromosome:Gm10
Start:29785437
stop:29787836
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G76860AT Annotation by Michelle Graham. TAIR10: Small nuclear ribonucleoprotein family protein | chr1:28854594-28855637 REVERSE LENGTH=98 SoyBaseE_val: 2.00E-30ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005732GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR13110Panther SNRNP SM PROTEIN JGI ISS
PF01423PFAM LSM domain JGI ISS
UniRef100_B9T2G3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Snrnp sm protein, putative n=1 Tax=Ricinus communis RepID=B9T2G3_RICCO SoyBaseE_val: 4.00E-31ISS
UniRef100_UPI000233C34CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C34C related cluster n=1 Tax=unknown RepID=UPI000233C34C SoyBaseE_val: 6.00E-35ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g23581 not represented in the dataset

Glyma10g23581 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g120000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g23581.1   sequence type=CDS   gene model=Glyma10g23581   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCAGAAGAAGAGAGCGCTGTGAAGGAGCCTTTGAATCTCATATGGCTTAGCCTCGACGAGCGTATCTACGTCAAGCTCCGTTCTGACAGAGAGCTTCGCGGCAAACTTCACGCTTATGATCAGCATCTTAATATTGTTCTTGGTGATGTTGAAGAAATTGTTACTACTGTGGAAATCATTGCTGGCAAATTTGAATAA

>Glyma10g23581.1   sequence type=predicted peptide   gene model=Glyma10g23581   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASEEESAVKEPLNLIWLSLDERIYVKLRSDRELRGKLHAYDQHLNIVLGDVEEIVTTVEIIAGKFE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo