SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g23531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g23531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g23531

Feature Type:gene_model
Chromosome:Gm10
Start:29722905
stop:29723403
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g23531
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56750AT Annotation by Michelle Graham. TAIR10: N-MYC downregulated-like 1 | chr5:22957986-22960606 FORWARD LENGTH=346 SoyBaseE_val: 4.00E-31ISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0060918GO-bp Annotation by Michelle Graham. GO Biological Process: auxin transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR11034Panther N-MYC DOWNSTREAM REGULATED JGI ISS
PTHR11034:SF3Panther N-MYC DOWNSTREAM REGULATED-RELATED JGI ISS
PF03096PFAM Ndr family JGI ISS
UniRef100_G7LJK8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pollen specific protein SF21 n=1 Tax=Medicago truncatula RepID=G7LJK8_MEDTR SoyBaseE_val: 8.00E-30ISS
UniRef100_I3T7H7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Medicago truncatula RepID=I3T7H7_MEDTR SoyBaseE_val: 4.00E-31ISS

Expression Patterns of Glyma10g23531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g23531 not represented in the dataset
Glyma10g23531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g23531 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g119500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g23531
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g23531
>Glyma10g23531.1   sequence type=CDS   gene model=Glyma10g23531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGTCATAGTCTATGGCGATCCTGACAAACCAGCTTTGATCACTTATCCAAATTTGGCTCTAAATTATATGTCATGTTTTCAAGGACTATTTTTCTGTCCAGAAGCAGCTTCTTTACTGCTTCACAACTTTTGCATATATCATATCAGTCCGCCTGGACATGAGTTTTCCCTCGGAAACTTCCACAAGAGTTCTTGA
Predicted protein sequences of Glyma10g23531
>Glyma10g23531.1   sequence type=predicted peptide   gene model=Glyma10g23531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSVIVYGDPDKPALITYPNLALNYMSCFQGLFFCPEAASLLLHNFCIYHISPPGHEFSLGNFHKSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo