Glyma10g23150 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g23150

Feature Type:	gene_model
Chromosome:	Gm10
Start:	29339822
stop:	29341819
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g23150

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14110	AT	Annotation by Michelle Graham. TAIR10: COP9 signalosome, subunit CSN8 \| chr4:8133049-8134867 REVERSE LENGTH=197	SoyBase	E_val: 2.00E-78	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0000338	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein deneddylation	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0009416	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light stimulus	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0010387	GO-bp	Annotation by Michelle Graham. GO Biological Process: signalosome assembly	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008180	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: signalosome	SoyBase	N/A	ISS
GO:0004222	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG4414	KOG	COP9 signalosome, subunit CSN8	JGI		ISS
PTHR13339	Panther	COP9 SIGNALOSOME COMPLEX SUBUNIT 8	JGI		ISS
PF10075	PFAM	COP9 signalosome, subunit CSN8	JGI		ISS
UniRef100_G7IL66	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: COP9 signalosome complex subunit n=1 Tax=Medicago truncatula RepID=G7IL66_MEDTR	SoyBase	E_val: 2.00E-90	ISS
UniRef100_UPI000233C349	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C349 related cluster n=1 Tax=unknown RepID=UPI000233C349	SoyBase	E_val: 2.00E-123	ISS

Expression Patterns of Glyma10g23150

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g23150 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g118600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g23150

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g23150

Limit To All Plant Sequences

>Glyma10g23150.2   sequence type=CDS   gene model=Glyma10g23150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTCTCTTCGGTGAGAGCTGCATTGGATTCGAAGTCGTACGACAAGGTTGCGGATGTGTGCGACAACTTGATGCTTCAGGTTGCAGCTGACGGCATTGCTTATCAGGACGATTGGCCCTATGCAATTCATCTTCTCTCTCACATTTATGTTCACGACATTATATATGTTGAGAGCCAGCCTGAAGTCACTGCGGTTTGGAAAATTGGTCAGAAGCTCTGGTTACGTGACTATGCCAGAGTGCATGAGGCAATCCGTGGCTTTGATTGGACTCAGGAACTCCAAGCCCTAGTTGCTGCATTTTCAGAACTTTACGCAAAGGAGATGTTTCAGCTGCTTCTCTCTGCTTATTCTATGATAAGCATTAAAGACACTGCTTTATTTCTGGGAATGAACGAGGATGATGCTACAAATTATGTACTGCAGCAAGGCTGGACTGTGGACCCTACCTCTCGGATGCTTATTGTGAAGAAGCAGCCTGCTGTGACACAGCAGAAACTTGATCCTAGTAAATTGCAGCGATTGACAGAATGTCTTCCATCTTGA

Predicted protein sequences of Glyma10g23150

Limit To All Plant Sequences

>Glyma10g23150.2   sequence type=predicted peptide   gene model=Glyma10g23150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDFSSVRAALDSKSYDKVADVCDNLMLQVAADGIAYQDDWPYAIHLLSHIYVHDIIYVESQPEVTAVWKIGQKLWLRDYARVHEAIRGFDWTQELQALVAAFSELYAKEMFQLLLSAYSMISIKDTALFLGMNEDDATNYVLQQGWTVDPTSRMLIVKKQPAVTQQKLDPSKLQRLTECLPS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain