Glyma10g23140 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g23140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g23140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g23140

Feature Type:	gene_model
Chromosome:	Gm10
Start:	29311076
stop:	29313170
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g23140

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G62810	AT	Annotation by Michelle Graham. TAIR10: peroxin 14 \| chr5:25220323-25223571 FORWARD LENGTH=507	SoyBase	E_val: 3.00E-44	ISS
GO:0006625	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to peroxisome	SoyBase	N/A	ISS
GO:0007031	GO-bp	Annotation by Michelle Graham. GO Biological Process: peroxisome organization	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein transporter activity	SoyBase	N/A	ISS
PTHR23058	Panther	PEROXISOMAL MEMBRANE PROTEIN PEX14	JGI		ISS
PF04695	PFAM	Peroxisomal membrane anchor protein (Pex14p) conserved region	JGI		ISS
UniRef100_G7JNV8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal membrane protein PEX14 n=1 Tax=Medicago truncatula RepID=G7JNV8_MEDTR	SoyBase	E_val: 5.00E-48	ISS
UniRef100_UPI000233C615	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C615 related cluster n=1 Tax=unknown RepID=UPI000233C615	SoyBase	E_val: 1.00E-91	ISS

Expression Patterns of Glyma10g23140

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g23140 not represented in the dataset	Glyma10g23140 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g23140 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g23140

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g23140

Limit To All Plant Sequences

>Glyma10g23140.1   sequence type=CDS   gene model=Glyma10g23140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGTTTAGACACATCGGTGTTTGTGAACTCAGAGCCATTGCGTGAGGCACAAATTCATAATGCTGTGAAATTTTTGTCGCACCTGAAAGTTAGAGGTTCTCCTGTCACCCATAGACGATCATTTTTGGAGAAGAAGGGTCTTATGAAGGAGGAGATTGATGAAGCCTTTCGGCGTGTGCCTGATTCACCTCTAAGTGTGCAGACATCTGGCATAAATCAAGAACTGGAATTCCTCATTCATATATTTCTCGGTTTGACATATCTTTCTTTATTTGTACCTAACTTAATTTCTTGCTCTATCCATAAATTTTTATCACTTTGTGGTTTGAATTCTATTCTCCCTCGGTTAAAATCTTGGATACACAATGTTGTCCGAGAAAAGGGTCATGACCAATCAAAGAGAACAAGCTCAAAACCAACATTGGCAGAAGAGGCTGCACAGGTTGCAAAAGCAGTTGCAGTTGCAGTTGCAGATGTTGATATTGCAAAAGCAAGCCAAGAACTACTGAGTTCAAAAATTGAAGAGAAGAGATATTTTGTAGAAGTTGTGAACCTTTTGGATAAGCAAGTGCAGGAAATGAAGTTGATGACTAATGCAATAAGAAGATTGGAAGGGTGTTTCCCTCGCTCCTACATATCCTCAATTGCGAGGAGGAAATCATACCTACGTAGTTCTTTCAGAACTAAACGTTGGTTAAGTTTTTTTAATCATTTTCCGCAAGATCAATTTTAA

Predicted protein sequences of Glyma10g23140

Limit To All Plant Sequences

>Glyma10g23140.1   sequence type=predicted peptide   gene model=Glyma10g23140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SLDTSVFVNSEPLREAQIHNAVKFLSHLKVRGSPVTHRRSFLEKKGLMKEEIDEAFRRVPDSPLSVQTSGINQELEFLIHIFLGLTYLSLFVPNLISCSIHKFLSLCGLNSILPRLKSWIHNVVREKGHDQSKRTSSKPTLAEEAAQVAKAVAVAVADVDIAKASQELLSSKIEEKRYFVEVVNLLDKQVQEMKLMTNAIRRLEGCFPRSYISSIARRKSYLRSSFRTKRWLSFFNHFPQDQF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain