Glyma10g23084 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g23084): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g23084): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g23084

Feature Type:	gene_model
Chromosome:	Gm10
Start:	29197361
stop:	29198701
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g23084

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G61620	AT	Annotation by Michelle Graham. TAIR10: myb-like transcription factor family protein \| chr5:24772383-24773507 FORWARD LENGTH=317	SoyBase	E_val: 2.00E-32	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR25040	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR25040:SF29	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_D7MV43	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Myb family transcription factor n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MV43_ARALL	SoyBase	E_val: 1.00E-30	ISS
UniRef100_I1LAE3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LAE3_SOYBN	SoyBase	E_val: 2.00E-37	ISS

Expression Patterns of Glyma10g23084

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g23084 not represented in the dataset	Glyma10g23084 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g23084 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g118400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g23084

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g23084

Limit To All Plant Sequences

>Glyma10g23084.1   sequence type=CDS   gene model=Glyma10g23084   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAAGGAAACAATGACATGCAATGAGAAAAGTGAAGGGTGTTTGATGCTATTTGGTGTGAACATTCTTGCAAAGAACCCTATAAGAGATGGTGTCCCCAAATGTTCAAGTATGCTAAACCGCAGTTATTGCCATGGAGAGGAGGAGATTAATGCCAATAAAGAAAATTCTGAAGGTGGATATTTGTCTGATGTTCTTGTTCAACAACGACATAACTTCCATGACAAGAAAAATAAGGGAAAACCTTGGACTGAGAAAGAACATAAGGATTTCCTAAGTGGTTTAAAGCATCTTGGAAAAGGTAACTGGAAGGAAATCTCAAAGAACTATGTGAGAACAAAGACTCCCACCCAAGTTGCAAGTCATGCACAAAAGTATTTTCTTAGAATTGGTGCTATCGAGACAAGAAAACGTAGAAGAAGCCTCTTTGACATACCATTGGAAGAGGATGGAACTTCAAAAGTTTTCCGAGATTCCCATTAA

Predicted protein sequences of Glyma10g23084

Limit To All Plant Sequences

>Glyma10g23084.1   sequence type=predicted peptide   gene model=Glyma10g23084   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMKETMTCNEKSEGCLMLFGVNILAKNPIRDGVPKCSSMLNRSYCHGEEEINANKENSEGGYLSDVLVQQRHNFHDKKNKGKPWTEKEHKDFLSGLKHLGKGNWKEISKNYVRTKTPTQVASHAQKYFLRIGAIETRKRRRSLFDIPLEEDGTSKVFRDSH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain