SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g22972

Feature Type:gene_model
Chromosome:Gm10
Start:29181685
stop:29182512
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g22972
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54770AT Annotation by Michelle Graham. TAIR10: thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) | chr5:22246634-22247891 FORWARD LENGTH=349 SoyBaseE_val: 3.00E-12ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0006974GO-bp Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus SoyBaseN/AISS
GO:0009228GO-bp Annotation by Michelle Graham. GO Biological Process: thiamine biosynthetic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0018131GO-bp Annotation by Michelle Graham. GO Biological Process: oxazole or thiazole biosynthetic process SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010319GO-cc Annotation by Michelle Graham. GO Cellular Compartment: stromule SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
UniRef100_D6N3H1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thiazole biosynthetic enzyme n=1 Tax=Gossypium hirsutum RepID=D6N3H1_GOSHI SoyBaseE_val: 1.00E-10ISS
UniRef100_UPI000233A80BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A80B related cluster n=1 Tax=unknown RepID=UPI000233A80B SoyBaseE_val: 6.00E-23ISS

Expression Patterns of Glyma10g22972
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g22972 not represented in the dataset
Glyma10g22972 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g22972 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g22972
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g22972
>Glyma10g22972.1   sequence type=CDS   gene model=Glyma10g22972   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGTTCACAAGCCGTTGGGCACTGAACTGTTAACAAAGACAAACTTCAATTGGAAAATAACTTGGGCCTCAAAGCCCAAGAAGTGTTATTGCATCGTTGTACTGCCACGAAATGAGTTGGAAGTGAAAGCAGAAGACACAACACACACTATACCATGCCTTCTGCTCCTTCCAAACTCTACGCAAGTTCTCTGCACTCTCTCAATCCCTTATTCACTATATATGCAGGGTCCGATGTTTGGGGCGATGATGATATCAAAGCAGAAGGTGGCTCATTTGGCATTGAAGCCATTGGGGAGGAACAATGCAATTGATGGAACGTGTGGAGTTGGAACGAAAGATCCCCAGCTTATTTTTGCTTCTGCAGACATTGAGGAAATTGTTGATGATTAA
Predicted protein sequences of Glyma10g22972
>Glyma10g22972.1   sequence type=predicted peptide   gene model=Glyma10g22972   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVHKPLGTELLTKTNFNWKITWASKPKKCYCIVVLPRNELEVKAEDTTHTIPCLLLLPNSTQVLCTLSIPYSLYMQGPMFGAMMISKQKVAHLALKPLGRNNAIDGTCGVGTKDPQLIFASADIEEIVDD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo