SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g22916

Feature Type:gene_model
Chromosome:Gm10
Start:29157927
stop:29161362
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G44280AT Annotation by Michelle Graham. TAIR10: RING 1A | chr5:17836115-17839114 REVERSE LENGTH=522 SoyBaseE_val: 3.00E-32ISS
GO:0001709GO-bp Annotation by Michelle Graham. GO Biological Process: cell fate determination SoyBaseN/AISS
GO:0010076GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of floral meristem identity SoyBaseN/AISS
GO:0010077GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of inflorescence meristem identity SoyBaseN/AISS
GO:0010492GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of shoot apical meristem identity SoyBaseN/AISS
GO:0045814GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of gene expression, epigenetic SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0035102GO-cc Annotation by Michelle Graham. GO Cellular Compartment: PRC1 complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR10825Panther RING FINGER PROTEIN JGI ISS
PTHR10825:SF4Panther gb def: agcp5478 [anopheles gambiae str. pest] JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_B6U5U6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein n=1 Tax=Zea mays RepID=B6U5U6_MAIZE SoyBaseE_val: 2.00E-29ISS
UniRef100_D7TJC2UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=D7TJC2_VITVI SoyBaseE_val: 6.00E-35ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g22916 not represented in the dataset

Glyma10g22916 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g118200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g22916.1   sequence type=CDS   gene model=Glyma10g22916   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTGCATGCACCGATTTTGCAAAGAATGCATTGAGAAATCAATGCGCCTTGGTAACAATGAATGCCCCGTTTGTCGCACACATGTTGCTAGTCGACGGTCATTGAGACATGACCAAAACTTTGATACTCTAATTTCTCTTTTGTATCCTGACATGGACAAGTATGAGAAAAAAGAGGAATTGACATTGCATGAGAATGAGAAGACTCACAATAAAGAGATGATCCAAGCTTCTAGTTCCCAGATTCTCCCATGTCAAACTGAAGCATTGTATAGGAAACAGAAAGCCAGGTCAATAGCTGTAGATTCTGAGAGGAAGAGGAGGTCAAAAGCTATCCCTGTTAAAATCTCTGATCAAGCTGAAGCTGAGAATTCGGATAATGATGGTGACGAGAGTCAAGAAGCTTCTAGAAAAACAACTTCTAGTAAAAGGAAAGCATCCTCCACAACTGCTAGTGAAAAGGTTCTCGAAGAAGTTTTTAAAGAAGTGAAAGAGGCTTCTAAAGATTCGTTGGATGAAGATTCTGAGTATGGTATTCGACAAAGTACTTCATTCAAATCTGATCCCTGCGTGAAATCAAGAAGAAAGGTATGTCAAAAGGTTCTATAA

>Glyma10g22916.1   sequence type=predicted peptide   gene model=Glyma10g22916   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MECMHRFCKECIEKSMRLGNNECPVCRTHVASRRSLRHDQNFDTLISLLYPDMDKYEKKEELTLHENEKTHNKEMIQASSSQILPCQTEALYRKQKARSIAVDSERKRRSKAIPVKISDQAEAENSDNDGDESQEASRKTTSSKRKASSTTASEKVLEEVFKEVKEASKDSLDEDSEYGIRQSTSFKSDPCVKSRRKVCQKVL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo