SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g22840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g22840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g22840

Feature Type:gene_model
Chromosome:Gm10
Start:28865255
stop:28866634
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26060AT Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein | chr2:11102400-11105081 FORWARD LENGTH=337 SoyBaseE_val: 1.00E-69ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0051604GO-bp Annotation by Michelle Graham. GO Biological Process: protein maturation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005834GO-cc Annotation by Michelle Graham. GO Cellular Compartment: heterotrimeric G-protein complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
PTHR19920Panther WD REPEAT CONTAINING PROTEIN JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_B9SRX4UniRef Annotation by Michelle Graham. Most informative UniRef hit: WD-repeat protein, putative n=1 Tax=Ricinus communis RepID=B9SRX4_RICCO SoyBaseE_val: 2.00E-75ISS
UniRef100_I1JQ18UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQ18_SOYBN SoyBaseE_val: 3.00E-103ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g22840 not represented in the dataset

Glyma10g22840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g22840.1   sequence type=CDS   gene model=Glyma10g22840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTGGAAGAGATTCAGAGACTCGAATTCCACACCGATAAGGTTTGGAGCTTGGCTTGGAACCCGACCTCCAGTCTCGACGGTATCCCACTCATCTTCGCTTCTTGCAACGGCGACAAAACCGTCCGAATCTGGGAGCAGAACCTCTCCTCTAGCCTCTGGGCTTGCACAGTCTTTTCTCAACCCAATTTTCATCATCAATTTGAGCGGTTTTGGATGAAACGCACACTCGAACTGTTCGATCTTGTGCTTGGTCACCGTCGGGTAAGCTATTGGCCACTGCAAGCTTCGATGCCACCACTGCCTATTTGGGAAAATGTTGGTGGTGATTTTGAGTGTGTTTCTACTTTGGAGGGACATGAAAATGAAGTGAAGTGTGTGTCTTGGAACGCGGCTGGGACGTTGCTTGCAACTTGTAGTAGAGATAAGTCTGTTTGGATATGGGAAGTGCTGCCCGGGAATGAGTTTGAGTGTGTGTCAGTGCTGCAAGGACACACGCAGGATGTGAAAATGGTGAAGTGGCATCCCACAGAGGATATCTTGTTTTCATGTTGCTACGATAATAGTGTTAAGGTTTGGGCGGATGAAGGTGATAGTGATGATTGGCAGTCTTCTTGGTTTTCTTCTCTTTTAGCCATGATTGCTTTTTCCATATTTTATGGAATATGTTTTACACTAGTCTATGTATGGGAAACAGAAAGAGTAGGGACGCAATCTGGTGGTGGATTTGCACCT

>Glyma10g22840.1   sequence type=predicted peptide   gene model=Glyma10g22840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LEEIQRLEFHTDKVWSLAWNPTSSLDGIPLIFASCNGDKTVRIWEQNLSSSLWACTVFSQPNFHHQFERFWMKRTLELFDLVLGHRRVSYWPLQASMPPLPIWENVGGDFECVSTLEGHENEVKCVSWNAAGTLLATCSRDKSVWIWEVLPGNEFECVSVLQGHTQDVKMVKWHPTEDILFSCCYDNSVKVWADEGDSDDWQSSWFSSLLAMIAFSIFYGICFTLVYVWETERVGTQSGGGFAP







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo