SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g22780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g22780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g22780

Feature Type:gene_model
Chromosome:Gm10
Start:28770718
stop:28771406
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g22780
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G51260AT Annotation by Michelle Graham. TAIR10: HAD superfamily, subfamily IIIB acid phosphatase | chr5:20832222-20833466 REVERSE LENGTH=257 SoyBaseE_val: 5.00E-30ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003993GO-mf Annotation by Michelle Graham. GO Molecular Function: acid phosphatase activity SoyBaseN/AISS
PF03767PFAM HAD superfamily, subfamily IIIB (Acid phosphatase) JGI ISS
UniRef100_G7L8K1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acid phosphatase n=1 Tax=Medicago truncatula RepID=G7L8K1_MEDTR SoyBaseE_val: 4.00E-32ISS
UniRef100_I1MG77UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MG77_SOYBN SoyBaseE_val: 8.00E-59ISS

Expression Patterns of Glyma10g22780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g22780 not represented in the dataset
Glyma10g22780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g22780 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g22780
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g22780
>Glyma10g22780.1   sequence type=CDS   gene model=Glyma10g22780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAGATTGAAGATACTGTAATCCTATTTGGAGTTGGGAATTTTATGCTTTTGTGGGATTTAAGAACTTTGTTTTGTACTCTTTGGGGAATGAATGACTTTAGACAGCTTGAGGTCTTTGACCACGAGAAGTTTAACAATTGGGTGGAGAAGGGTGTAGCTCCAGCCATTGAACCCAGTTTAAAGCTCTATGAAGATGTTTTGAATCTGGGATTCAAGGTTATTCTACTGACAGGACGGAGTGAAAGGCACAGGAGTGTCACTGTTGATAATTTGATCAATGCTGGGTTTAAGGAATGGGACCAGCTCATACTAAGCAGAGCAAATGAAGTTTGTATATTAAATAAATGTTGTAAGATTGGAATATATGTGTATGTTCTGTAA
Predicted protein sequences of Glyma10g22780
>Glyma10g22780.1   sequence type=predicted peptide   gene model=Glyma10g22780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EIEDTVILFGVGNFMLLWDLRTLFCTLWGMNDFRQLEVFDHEKFNNWVEKGVAPAIEPSLKLYEDVLNLGFKVILLTGRSERHRSVTVDNLINAGFKEWDQLILSRANEVCILNKCCKIGIYVYVL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo