SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g20994): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g20994): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g20994

Feature Type:gene_model
Chromosome:Gm10
Start:26687089
stop:26687965
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g20994
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATMG00580AT Annotation by Michelle Graham. TAIR10: NADH dehydrogenase subunit 4 | chrM:161693-169674 FORWARD LENGTH=495 SoyBaseE_val: 9.00E-83ISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0042773GO-bp Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled electron transport SoyBaseN/AISS
GO:0045333GO-bp Annotation by Michelle Graham. GO Biological Process: cellular respiration SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005747GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I SoyBaseN/AISS
GO:0003954GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity SoyBaseN/AISS
GO:0008137GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity SoyBaseN/AISS
PTHR22773Panther NADH DEHYDROGENASE JGI ISS
PTHR22773:SF40Panther NADH DEHYDROGENASE SUBUNIT 4 JGI ISS
UniRef100_G7I8T4UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH-ubiquinone oxidoreductase chain n=1 Tax=Medicago truncatula RepID=G7I8T4_MEDTR SoyBaseE_val: 6.00E-102ISS
UniRef100_I1LAA5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LAA5_SOYBN SoyBaseE_val: 1.00E-115ISS

Expression Patterns of Glyma10g20994
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g20994 not represented in the dataset
Glyma10g20994 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g20994 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g098500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g20994
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g20994
>Glyma10g20994.1   sequence type=CDS   gene model=Glyma10g20994   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAGCCCGGAACATTTCTGTGAATGCTATTCTGATCTAAGTGGTCTTATTCTGTGTCCCGTGCAAGGAAGCATTATTCCTCTTTTCATTCCAAATTCAAGAATACGACCGATACGATTGATTGGTCTGTGTGCCTCTCTTATTACTTTTTTGTATTCCCCTACTCCTCGGATACAATTCGATCCTTCTACGGTCAAATCTCAATTTGTGGAATGCCTTCGATGGCTTCCTTATGAAAACATCAATTTGAATTTGGGTATAGACGATCTCTCTTTTTTTTTCGTGATATTGACCACATTTCTGATCCCTATTTGTATTTTAATGGGTTGGTCTGGTATGAGAAGTTATGGGAAAGAGTACATTACAACATCTCTAATTCATGAATTTCTAATGATCGTCGTGCTCCGCATGCTGGATCCTCTACTATTCTATGTTCTTCCCGAAAGTGTGCTAATCCCTATGTTATGCGGAGCTGAGCATCTTCTATTCATTGGGATAAAGCTTTTCCTCTGCAGGAGGGGTAGTCTTGTGCATAAGCATAGCATTTCTGGTCGAACCCGCCCAACCCAACTAAGATGA
Predicted protein sequences of Glyma10g20994
>Glyma10g20994.1   sequence type=predicted peptide   gene model=Glyma10g20994   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSPEHFCECYSDLSGLILCPVQGSIIPLFIPNSRIRPIRLIGLCASLITFLYSPTPRIQFDPSTVKSQFVECLRWLPYENINLNLGIDDLSFFFVILTTFLIPICILMGWSGMRSYGKEYITTSLIHEFLMIVVLRMLDPLLFYVLPESVLIPMLCGAEHLLFIGIKLFLCRRGSLVHKHSISGRTRPTQLR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo