SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g20880

Feature Type:gene_model
Chromosome:Gm10
Start:26469276
stop:26470249
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g20880
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56000AT Annotation by Michelle Graham. TAIR10: HEAT SHOCK PROTEIN 81.4 | chr5:22677602-22680067 REVERSE LENGTH=699 SoyBaseE_val: 9.00E-134ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
PTHR11528Panther HEAT SHOCK PROTEIN 90 JGI ISS
PF00183PFAM Hsp90 protein JGI ISS
UniRef100_B6EBD6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein 90-2 n=1 Tax=Glycine max RepID=B6EBD6_SOYBN SoyBaseE_val: 2.00E-139ISS
UniRef100_I1M6E1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M6E1_SOYBN SoyBaseE_val: 1.00E-140ISS

Expression Patterns of Glyma10g20880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g20880 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g098300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g20880
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g20880
>Glyma10g20880.1   sequence type=CDS   gene model=Glyma10g20880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAGCATTATGAATTCATTAGCTATCCAATTTCTCTCTGGATTGAGAAGACTACTGAAAATGAGATTTCTGATGATAAGGATGAGGAAGAGAACAAGGATGAGGAGCATAAAGTTGAAGATGTGGATGAAGATAAGGAGAAGGATGAGAAGAAAAAGAAGACCATTAACGAGGTATCTCACGAGTGGTCATTGATTACAAAAGAAGAATATGCTGCTTTCTACAAGAGTCTTACCAATGATTTGGAAGAGCATTTGGCTGTTAAGCACTTTTCTGTTGAGGGTCAGCTGGAGTTTAAGGCTGTCCTCTTTATCCCCAAGAGGGCACCTTTTGATCTCTTTGACACTAGGAAGAAGCCTAACATCAAATTGTATGTTCGCCGTGTCTTCATCATGGACAACTGTGAGGAGTTGATGCCTGAATATCTTAGCTTTGTTAAGGGTATCCTTTGTTATGAGGATCTTCCTCTGAACATTTCTAGAGAAATGTTGCAGCAAAACAAGATCCTGAAAGTCATCAGGATGAACTTGGAAGACTATAACAAGTTTTATGAAGGATTCTCTAAGAACCTGAAACTTGGTATTCATGAGGATTCTCAGAACAAGACAAAGCTAGCTGAATTGCTCAGGTATGACTCCACTAAGATGAAGGAAGGACAGAATGACATCTACTACATTACTGGTGAAAGCAAGAAAGCTGTCGAGAATTCCCCCTTCCTTGAAAAGCTTAAGAAGAAGGGGTACGAGGTTCTCTACTTGGTTGATGCTATTGATGAGTATGTTGTTGGTCAACTTAAGGAATTTGAGGGAAAGAAGTTGGTCTCTGCTACCAAGGAAGGCCTAAAA
Predicted protein sequences of Glyma10g20880
>Glyma10g20880.1   sequence type=predicted peptide   gene model=Glyma10g20880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKHYEFISYPISLWIEKTTENEISDDKDEEENKDEEHKVEDVDEDKEKDEKKKKTINEVSHEWSLITKEEYAAFYKSLTNDLEEHLAVKHFSVEGQLEFKAVLFIPKRAPFDLFDTRKKPNIKLYVRRVFIMDNCEELMPEYLSFVKGILCYEDLPLNISREMLQQNKILKVIRMNLEDYNKFYEGFSKNLKLGIHEDSQNKTKLAELLRYDSTKMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYLVDAIDEYVVGQLKEFEGKKLVSATKEGLK






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo