SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g20880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g20880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g20880

Feature Type:gene_model
Chromosome:Gm10
Start:26469276
stop:26470249
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56000AT Annotation by Michelle Graham. TAIR10: HEAT SHOCK PROTEIN 81.4 | chr5:22677602-22680067 REVERSE LENGTH=699 SoyBaseE_val: 9.00E-134ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
PTHR11528Panther HEAT SHOCK PROTEIN 90 JGI ISS
PF00183PFAM Hsp90 protein JGI ISS
UniRef100_B6EBD6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein 90-2 n=1 Tax=Glycine max RepID=B6EBD6_SOYBN SoyBaseE_val: 2.00E-139ISS
UniRef100_I1M6E1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M6E1_SOYBN SoyBaseE_val: 1.00E-140ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g20880 not represented in the dataset

Glyma10g20880 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g098300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g20880.1   sequence type=CDS   gene model=Glyma10g20880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAGCATTATGAATTCATTAGCTATCCAATTTCTCTCTGGATTGAGAAGACTACTGAAAATGAGATTTCTGATGATAAGGATGAGGAAGAGAACAAGGATGAGGAGCATAAAGTTGAAGATGTGGATGAAGATAAGGAGAAGGATGAGAAGAAAAAGAAGACCATTAACGAGGTATCTCACGAGTGGTCATTGATTACAAAAGAAGAATATGCTGCTTTCTACAAGAGTCTTACCAATGATTTGGAAGAGCATTTGGCTGTTAAGCACTTTTCTGTTGAGGGTCAGCTGGAGTTTAAGGCTGTCCTCTTTATCCCCAAGAGGGCACCTTTTGATCTCTTTGACACTAGGAAGAAGCCTAACATCAAATTGTATGTTCGCCGTGTCTTCATCATGGACAACTGTGAGGAGTTGATGCCTGAATATCTTAGCTTTGTTAAGGGTATCCTTTGTTATGAGGATCTTCCTCTGAACATTTCTAGAGAAATGTTGCAGCAAAACAAGATCCTGAAAGTCATCAGGATGAACTTGGAAGACTATAACAAGTTTTATGAAGGATTCTCTAAGAACCTGAAACTTGGTATTCATGAGGATTCTCAGAACAAGACAAAGCTAGCTGAATTGCTCAGGTATGACTCCACTAAGATGAAGGAAGGACAGAATGACATCTACTACATTACTGGTGAAAGCAAGAAAGCTGTCGAGAATTCCCCCTTCCTTGAAAAGCTTAAGAAGAAGGGGTACGAGGTTCTCTACTTGGTTGATGCTATTGATGAGTATGTTGTTGGTCAACTTAAGGAATTTGAGGGAAAGAAGTTGGTCTCTGCTACCAAGGAAGGCCTAAAA

>Glyma10g20880.1   sequence type=predicted peptide   gene model=Glyma10g20880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKHYEFISYPISLWIEKTTENEISDDKDEEENKDEEHKVEDVDEDKEKDEKKKKTINEVSHEWSLITKEEYAAFYKSLTNDLEEHLAVKHFSVEGQLEFKAVLFIPKRAPFDLFDTRKKPNIKLYVRRVFIMDNCEELMPEYLSFVKGILCYEDLPLNISREMLQQNKILKVIRMNLEDYNKFYEGFSKNLKLGIHEDSQNKTKLAELLRYDSTKMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYLVDAIDEYVVGQLKEFEGKKLVSATKEGLK







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo