SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g20845

Feature Type:gene_model
Chromosome:Gm10
Start:26434088
stop:26435369
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g20845
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G36860AT Annotation by Michelle Graham. TAIR10: LIM domain-containing protein | chr4:17358580-17361189 REVERSE LENGTH=553 SoyBaseE_val: 2.00E-46ISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR24209Panther FAMILY NOT NAMED JGI ISS
PF12315PFAM Protein of unknown function (DUF3633) JGI ISS
UniRef100_G7LFK8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Disease resistance-like protein n=1 Tax=Medicago truncatula RepID=G7LFK8_MEDTR SoyBaseE_val: 2.00E-45ISS
UniRef100_I1LSV1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LSV1_SOYBN SoyBaseE_val: 2.00E-56ISS

Expression Patterns of Glyma10g20845
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g20845 not represented in the dataset
Glyma10g20845 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g20845 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g098200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g20845
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g20845
>Glyma10g20845.1   sequence type=CDS   gene model=Glyma10g20845   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTTGGTGCTTGGTTATTTTTAAAGTATAAAGGGGAAGGACTTTTCAAGATAAAAGTCTTTGATTTCATTTTGAATGAAATAGAGCAGCAAGTTCCGATGCTTTTGGTTGAGAGACAAGCACTGAACGAGGCTATGGAGGGAGAGAAGAATGGTCATCATCACTTACCTGAAACCAGAGGACTTTGCTTGTCCGAAGAGCAAACTGTTCCCACTATTTTAAGGAGACCAAGGATAGGAGCAGGATACCAGCTCATAGATATCATAACCGAGCCTTTTAGGCTGGTCCGTCGTTGTGAAGTGACAGCCATACTTGTTTTGTATGGCCTTCCTAGGTATCCTTCTGATATCGTCTATTTTCAAAATCTATAG
Predicted protein sequences of Glyma10g20845
>Glyma10g20845.1   sequence type=predicted peptide   gene model=Glyma10g20845   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDFGAWLFLKYKGEGLFKIKVFDFILNEIEQQVPMLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVPTILRRPRIGAGYQLIDIITEPFRLVRRCEVTAILVLYGLPRYPSDIVYFQNL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo