Glyma10g20830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g20830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g20830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g20830

Feature Type:	gene_model
Chromosome:	Gm10
Start:	26431484
stop:	26431962
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g20830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13180	AT	Annotation by Michelle Graham. TAIR10: NAC domain containing protein 83 \| chr5:4196643-4197577 FORWARD LENGTH=252	SoyBase	E_val: 7.00E-62	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0007275	GO-bp	Annotation by Michelle Graham. GO Biological Process: multicellular organismal development	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009741	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus	SoyBase	N/A	ISS
GO:0009963	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010089	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylem development	SoyBase	N/A	ISS
GO:0010150	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf senescence	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF02365	PFAM	No apical meristem (NAM) protein	JGI		ISS
UniRef100_B2ZGQ8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAC domain protein n=1 Tax=Glycine max RepID=B2ZGQ8_SOYBN	SoyBase	E_val: 2.00E-78	ISS
UniRef100_UPI000233C49F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C49F related cluster n=1 Tax=unknown RepID=UPI000233C49F	SoyBase	E_val: 5.00E-95	ISS

Expression Patterns of Glyma10g20830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g20830 not represented in the dataset	Glyma10g20830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g20830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g20830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g20830

Limit To All Plant Sequences

>Glyma10g20830.2   sequence type=CDS   gene model=Glyma10g20830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCTGGTTCTGCAATACTTGAAGCGCAAGGTCTTCTCCTGCCCTTTGCCAGCCTCTATCATTCCTGAGCTTCATGTTTGCAAGTCTGATCCTTGGGATTTGCCAGGTGATTTGGAGCAAGAGAGATACTTCTTTAGCACCAAAGTGGCCAAATATCCCAACGGAAATCGCTCCAACAGAGCCACAAATTCGGGTTATTGGAAGGCAACTGGTTTGGACAAACAAATTGTTACTTCAAAAGGGAACAACCAAGTTTTCGAAATGAATAAGACACTTGTTTTCTGCAGAGGCAAGCCTCCTTATGGATCCAGAACTGATTGGATCATGCACGAGTATCGCCTCATCCTTAACGGCTCTCAGTCTAAGGTGAGGCCAAACAAACTTCTACTATTTATGTAA

Predicted protein sequences of Glyma10g20830

Limit To All Plant Sequences

>Glyma10g20830.2   sequence type=predicted peptide   gene model=Glyma10g20830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELVLQYLKRKVFSCPLPASIIPELHVCKSDPWDLPGDLEQERYFFSTKVAKYPNGNRSNRATNSGYWKATGLDKQIVTSKGNNQVFEMNKTLVFCRGKPPYGSRTDWIMHEYRLILNGSQSKVRPNKLLLFM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain