Report for Sequence Feature Glyma10g17530
Feature Type: gene_model
Chromosome: Gm10
Start: 21110480
stop: 21111604
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g17530
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G08780 AT
Annotation by Michelle Graham. TAIR10: ABI3-interacting protein 3 | chr1:2809925-2811126 REVERSE LENGTH=129
SoyBase E_val: 5.00E-23 ISS
GO:0006457 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein folding
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0016272 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: prefoldin complex
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0051082 GO-mf
Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding
SoyBase N/A ISS
GO:0051087 GO-mf
Annotation by Michelle Graham. GO Molecular Function: chaperone binding
SoyBase N/A ISS
PTHR21100 Panther
FAMILY NOT NAMED
JGI ISS
PTHR21100:SF6 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF01920 PFAM
Prefoldin subunit
JGI ISS
UniRef100_B9SZ63 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Prefoldin subunit, putative n=1 Tax=Ricinus communis RepID=B9SZ63_RICCO
SoyBase E_val: 2.00E-22 ISS
UniRef100_I1LA68 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LA68_SOYBN
SoyBase E_val: 2.00E-34 ISS
Expression Patterns of Glyma10g17530
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma10g17530 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma10g17530
Coding sequences of Glyma10g17530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g17530.1 sequence type=CDS gene model=Glyma10g17530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATCAAGGTTTTTGCTCATGTGCCAAAGGACGAAGTTGAGAATAGGATAGAACAGATAAACAAGGTGACAAGCCAGAAATTAGAAAAACTTGAAGAGGAGAAAGAATCTATTCTTGCTCAGATGGCTGAACTCAAGAAAATTTTGTATGCGAAGTTCAATGACTCGATCAATCTTGAGGAGGATTAG
Predicted protein sequences of Glyma10g17530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g17530.1 sequence type=predicted peptide gene model=Glyma10g17530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MIKVFAHVPKDEVENRIEQINKVTSQKLEKLEEEKESILAQMAELKKILYAKFNDSINLEED*