|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G08780 | AT | Annotation by Michelle Graham. TAIR10: ABI3-interacting protein 3 | chr1:2809925-2811126 REVERSE LENGTH=129 | SoyBase | E_val: 5.00E-23 | ISS |
GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0016272 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: prefoldin complex | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
GO:0051082 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding | SoyBase | N/A | ISS |
GO:0051087 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chaperone binding | SoyBase | N/A | ISS |
PTHR21100 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR21100:SF6 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
PF01920 | PFAM | Prefoldin subunit | JGI | ISS | |
UniRef100_B9SZ63 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Prefoldin subunit, putative n=1 Tax=Ricinus communis RepID=B9SZ63_RICCO | SoyBase | E_val: 2.00E-22 | ISS |
UniRef100_I1LA68 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LA68_SOYBN | SoyBase | E_val: 2.00E-34 | ISS |
Glyma10g17530 not represented in the dataset |
Glyma10g17530 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma10g17530.1 sequence type=CDS gene model=Glyma10g17530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATCAAGGTTTTTGCTCATGTGCCAAAGGACGAAGTTGAGAATAGGATAGAACAGATAAACAAGGTGACAAGCCAGAAATTAGAAAAACTTGAAGAGGAGAAAGAATCTATTCTTGCTCAGATGGCTGAACTCAAGAAAATTTTGTATGCGAAGTTCAATGACTCGATCAATCTTGAGGAGGATTAG
>Glyma10g17530.1 sequence type=predicted peptide gene model=Glyma10g17530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIKVFAHVPKDEVENRIEQINKVTSQKLEKLEEEKESILAQMAELKKILYAKFNDSINLEED*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||