SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g17440

Feature Type:gene_model
Chromosome:Gm10
Start:20882745
stop:20882903
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g17440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G47930AT Annotation by Michelle Graham. TAIR10: L-galactono-1,4-lactone dehydrogenase | chr3:17684500-17687426 FORWARD LENGTH=610 SoyBaseE_val: 3.00E-24ISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0019853GO-bp Annotation by Michelle Graham. GO Biological Process: L-ascorbic acid biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0003885GO-mf Annotation by Michelle Graham. GO Molecular Function: D-arabinono-1,4-lactone oxidase activity SoyBaseN/AISS
GO:0008762GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-N-acetylmuramate dehydrogenase activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016614GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on CH-OH group of donors SoyBaseN/AISS
GO:0016633GO-mf Annotation by Michelle Graham. GO Molecular Function: galactonolactone dehydrogenase activity SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
GO:0080049GO-mf Annotation by Michelle Graham. GO Molecular Function: L-gulono-1,4-lactone dehydrogenase activity SoyBaseN/AISS
PTHR13878Panther GULONOLACTONE OXIDASE JGI ISS
PTHR13878:SF6Panther XYLITOL OXIDASE JGI ISS
UniRef100_C3V9A8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial L-galactono-1,4-lactone dehydrogenase n=1 Tax=Citrus unshiu RepID=C3V9A8_CITUN SoyBaseE_val: 1.00E-24ISS
UniRef100_UPI000233C1DCUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C1DC related cluster n=1 Tax=unknown RepID=UPI000233C1DC SoyBaseE_val: 3.00E-26ISS

Expression Patterns of Glyma10g17440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g17440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g17440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g17440
>Glyma10g17440.1   sequence type=CDS   gene model=Glyma10g17440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTCCAAAGGACAAGGAGGAGCTTGCAGCCCTCCAAGCAAGGCTAAGAAAGCGGTTTCCTGTGGATGCATACAATAAAGCAAGAAAGGAATTGGACCCCAATAGGATCCTTTCGAACAACATGTTGGAAAAGCTCTTCCCACAATCAGACACCATATAA
Predicted protein sequences of Glyma10g17440
>Glyma10g17440.1   sequence type=predicted peptide   gene model=Glyma10g17440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VPKDKEELAALQARLRKRFPVDAYNKARKELDPNRILSNNMLEKLFPQSDTI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo