SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g17161): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g17161): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g17161

Feature Type:gene_model
Chromosome:Gm10
Start:20218705
stop:20219395
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03730AT Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr5:974958-979660 REVERSE LENGTH=821 SoyBaseE_val: 7.00E-10ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0009686GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0010105GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0048510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase SoyBaseN/AISS
GO:0071281GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion SoyBaseN/AISS
GO:2000035GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stem cell division SoyBaseN/AISS
GO:2000069GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of post-embryonic root development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005789GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004712GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine/tyrosine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
UniRef100_G7I7V3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine protein kinase 1 CTR1 n=1 Tax=Medicago truncatula RepID=G7I7V3_MEDTR SoyBaseE_val: 5.00E-37ISS
UniRef100_UPI0002337131UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337131 related cluster n=1 Tax=unknown RepID=UPI0002337131 SoyBaseE_val: 1.00E-52ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g17161 not represented in the dataset

Glyma10g17161 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g17161.1   sequence type=CDS   gene model=Glyma10g17161   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGGACCTGCTGTTAATCATAGTGGCAGAATGGATCTACAGCAAATTGAAGCTCTGGGTGCTAATTATGCTGGTGGAAACAACCATCTGATTACTTTGATTTGTGGTGCAGAGGAATACGAGTCTTTCAATGAAGTAGACCGGTCAATAATGGATTACCCAAGTCATGAAGTTGATCTTGACGAGGAGGATCTAGATATTCCATGGAGTGAACTTATTTTGAAGGAGAACATTGGGACAGGGTCATTTGGAACTTTCCTTCGTGCAGACTGGCGTGGTTCTATAAGAATTTCTTTGTTTAATTCTTTACATATTCATTTGTCCATATTTTAA

>Glyma10g17161.1   sequence type=predicted peptide   gene model=Glyma10g17161   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTGPAVNHSGRMDLQQIEALGANYAGGNNHLITLICGAEEYESFNEVDRSIMDYPSHEVDLDEEDLDIPWSELILKENIGTGSFGTFLRADWRGSIRISLFNSLHIHLSIF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo