SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g16340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g16340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g16340

Feature Type:gene_model
Chromosome:Gm10
Start:19375160
stop:19377821
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G41460AT Annotation by Michelle Graham. TAIR10: apurinic endonuclease-redox protein | chr2:17285731-17288769 FORWARD LENGTH=536 SoyBaseE_val: 3.00E-70ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0008284GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016571GO-bp Annotation by Michelle Graham. GO Biological Process: histone methylation SoyBaseN/AISS
GO:0016579GO-bp Annotation by Michelle Graham. GO Biological Process: protein deubiquitination SoyBaseN/AISS
GO:0043687GO-bp Annotation by Michelle Graham. GO Biological Process: post-translational protein modification SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0051276GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome organization SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0042644GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast nucleoid SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003906GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-(apurinic or apyrimidinic site) lyase activity SoyBaseN/AISS
GO:0004518GO-mf Annotation by Michelle Graham. GO Molecular Function: nuclease activity SoyBaseN/AISS
GO:0004519GO-mf Annotation by Michelle Graham. GO Molecular Function: endonuclease activity SoyBaseN/AISS
PTHR22748Panther AP ENDONUCLEASE JGI ISS
PF03372PFAM Endonuclease/Exonuclease/phosphatase family JGI ISS
UniRef100_B9SVS9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ap endonuclease, putative n=1 Tax=Ricinus communis RepID=B9SVS9_RICCO SoyBaseE_val: 4.00E-71ISS
UniRef100_I1LA50UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LA50_SOYBN SoyBaseE_val: 5.00E-145ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g16340 not represented in the dataset

Glyma10g16340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g16340.1   sequence type=CDS   gene model=Glyma10g16340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCCTATTCGAAGCTATTTCCATACGATCCATATCAGCCACGCCCTCCCCCTTCTTCTTGTGATTGTCTTTATTTTGGTCCTGGCTCGCCTTTCCTCTCCCAAACTCCTTTGAAGCGTACAAATCCTTACCTTCTCCCTTCTTTGTTTCTCCTTTTGACCTCGCAGCTCCAGTGCAATTACCTTATCAAGCCACTTTCAGTTCGATATGGCCTAGGTATATCAGATCATGATAGTGAGGGTAGACTTGTAACGGCTGAGTTTGATACATTTTATTTGATATGTGGATATTCTTACAGGGTGACTGAATGGGATCCATCTCTCAGCAATTATTTGAAAGAGCTGGAGAAGTCAAAACCTGTAATTTTGACTGGTGATCTAAATTGTGCTCATGAAGAGATAGATATATACAACCCGGCTGGCAACAAGAGAAGTGCCGGGCTTACAGATGAAGAGAGGAAATCATTTGCAACGAACTTTTTATCTAGGGGATTTGTAGATACCTTTAGAAGGCAGCATCCTGGTGTTATTGGATATACTTATTGGGGTTACCGGCATGGTGGACGCAAGTTTAACAGAGAATCTAGTGGTATTATATGTAGATATTAA

>Glyma10g16340.1   sequence type=predicted peptide   gene model=Glyma10g16340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SYSKLFPYDPYQPRPPPSSCDCLYFGPGSPFLSQTPLKRTNPYLLPSLFLLLTSQLQCNYLIKPLSVRYGLGISDHDSEGRLVTAEFDTFYLICGYSYRVTEWDPSLSNYLKELEKSKPVILTGDLNCAHEEIDIYNPAGNKRSAGLTDEERKSFATNFLSRGFVDTFRRQHPGVIGYTYWGYRHGGRKFNRESSGIICRY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo